Heterocephalus glaber (naked mole-rat): 101697163 Help Entry 101697163         CDS       T02812                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04151   PI3K-Akt signaling pathway hgl04217   Necroptosis hgl04620   Toll-like receptor signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04622   RIG-I-like receptor signaling pathway hgl04623   Cytosolic DNA-sensing pathway hgl04630   JAK-STAT signaling pathway hgl04650   Natural killer cell mediated cytotoxicity hgl04936   Alcoholic liver disease hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05171   Coronavirus disease - COVID-19 hgl05200   Pathways in cancer hgl05320   Autoimmune thyroid disease hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101697163    04151 PI3K-Akt signaling pathway     101697163   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101697163  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101697163  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101697163    04621 NOD-like receptor signaling pathway     101697163    04622 RIG-I-like receptor signaling pathway     101697163    04623 Cytosolic DNA-sensing pathway     101697163    04650 Natural killer cell mediated cytotoxicity     101697163  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101697163   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101697163    05161 Hepatitis B     101697163    05160 Hepatitis C     101697163    05171 Coronavirus disease - COVID-19     101697163    05164 Influenza A     101697163    05162 Measles     101697163    05168 Herpes simplex virus 1 infection     101697163    05163 Human cytomegalovirus infection     101697163    05167 Kaposi sarcoma-associated herpesvirus infection     101697163    05169 Epstein-Barr virus infection     101697163    05165 Human papillomavirus infection     101697163   09171 Infectious disease: bacterial    05152 Tuberculosis     101697163   09163 Immune disease    05320 Autoimmune thyroid disease     101697163   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101697163   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101697163  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101697163 Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101697163 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  101697163 NCBI-ProteinID:  XP_004875569 UniProt:  A0AAX6QKW3 LinkDB All DBs Position Un AA seq 187 aa AA seqDB search MAWPLSVLVALVVLTIMSSCSLGCDLPRTHSQGNRRALTLLEQMRRISTFSCLKDREDFG LPHQEFDGKQIQKAQAISVLHEMTSQTFNLFSTQDSSAAWNNGLLDTFCTGLHQQLSDLE ACLTQEVGQEEAPISHEDSRLAVRKYFHRITLYLKEKRYSPCAWEVVRAEIMRSFSSSEK LARKVKD NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggcctggccactttctgtactggtggccctggtggtgctcaccatcatgtcatcgtgc tctctgggctgtgacctgcctcgaacccacagccaggggaacaggagggccttgacacta ctggaacaaatgaggagaatctccactttctcctgcctgaaggacagagaggactttggc ctcccccaccaggagtttgatggcaaacagatccagaaggctcaggccatctctgtcctc catgagatgaccagccagaccttcaacctcttcagcacacaggattcatctgccgcctgg aacaatggcctgctggacaccttctgcaccggcctccatcagcagctgagtgatctggag gcctgcctgacccaggaggtggggcaggaagaggcgcccatctcgcatgaggactccaga ctggctgtgaggaaatacttccacaggatcactctctacctgaaggagaagcgatacagc ccttgtgcctgggaagttgtcagagcagaaatcatgagatccttctcttcatcggagaaa cttgcaagaaaggtgaaagactaa

Heterocephalus glaber (naked mole-rat): 101697684 Help Entry 101697684         CDS       T02812                                  Symbol Ifnl3 Name (RefSeq) interferon lambda 3   KO K22669   interferon lambda 2/3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101697684 (Ifnl3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101697684 (Ifnl3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101697684 (Ifnl3) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101697684 (Ifnl3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL28A Motif Other DBs NCBI-GeneID:  101697684 NCBI-ProteinID:  XP_004859222 UniProt:  A0AAX6PVA6 LinkDB All DBs Position Un AA seq 171 aa AA seqDB search MKPDPAGGCVLLLLLLLCTVQTRSGEVPVPRPLSVSPDARGCHVAQLQSLSLEERQAFKT AKEALEERRLLKDSTCNSGLFFRAWDLGKLQVWERPMALQAELSLTLKVLASVTDQALWG IVKQPIHTLRHIHAQLRACESPGCLQASVTFNLFRLLTRDLRCVARPDLCA NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgaagccagaccccgctggaggttgcgtgctgctgctgctgctgctgctgtgcactgta cagaccaggtcaggggaagttcctgtccccagacccctcagtgtctccccggatgcaagg ggctgccacgtggcccagttgcaatctctgtccctagaagagaggcaggccttcaagaca gccaaggaagcattggaagagcggcgcctgctgaaggactccacctgcaactcggggctc ttcttcagggcctgggacctggggaagcttcaagtgtgggagcgccccatggccctgcag gctgagctctccctgacactgaaggtcttggcctcggtgacagaccaggccctgtggggc atcgtgaagcagccgattcacactctgcgtcacatccacgcccagctccgggcctgtgag tcccctggctgcctccaggcctctgtcaccttcaacctcttccgcctgctcacccgggac ctgagatgtgtggccaggccagacctgtgtgcctga

Heterocephalus glaber (naked mole-rat): 101698799 Help Entry 101698799         CDS       T02812                                  Name (RefSeq) interferon lambda-2-like   KO K22669   interferon lambda 2/3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101698799   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101698799  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101698799 Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101698799 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL28A Motif Other DBs NCBI-GeneID:  101698799 NCBI-ProteinID:  XP_012932835 UniProt:  A0AAX6R4D5 LinkDB All DBs Position Un AA seq 200 aa AA seqDB search MKPDPAGGCVLLLLLLLCTVQTRSGEVPVPRPLSVSPDARGCHVAQLQSLSLEERQAFKT AKEALEERRLLKDSTCNSGLFFRAWDLGKLQVWERPMALQAELSLTLKVLASVTDQALWG IVKQPIHTLRHIHAQLRACVPAQPKAAHRPCSHRLSRWLQRLNQATKKESPGCLQASVIS NLFFLLTRDLRCLARPDLCA NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atgaagccagaccccgctggaggttgcgtgctgctgctgctgctgctgctgtgcactgta cagaccaggtcaggggaagttcctgtccccagacccctcagtgtctccccggatgcaagg ggctgccacgtggcccagttgcaatctctgtccctagaagagaggcaggccttcaagaca gccaaggaagcattggaagagcggcgcctgctgaaggactccacctgcaactcggggctc ttcttcagggcctgggacctagggaagcttcaagtgtgggagcgccccatggccctgcag gctgagctctccctgacactgaaggtcttggcctcggtgacagaccaggccctgtggggc atcgtgaagcagccgattcacactctgcgtcacatccacgcccagctccgggcctgtgtc ccagctcagcccaaagcagcccacaggccctgcagccaccgcctgtcccgatggctgcag cggctcaaccaggccaccaagaaggagtcccctggctgcctccaggcctctgtcatctcc aacctcttcttcctgctcacccgggacctgagatgtttggccaggccagacctgtgtgcc tga

Heterocephalus glaber (naked mole-rat): 101699042 Help Entry 101699042         CDS       T02812                                  Symbol Ifnb1 Name (RefSeq) interferon beta 1   KO K05415   interferon beta Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04151   PI3K-Akt signaling pathway hgl04217   Necroptosis hgl04380   Osteoclast differentiation hgl04620   Toll-like receptor signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04622   RIG-I-like receptor signaling pathway hgl04623   Cytosolic DNA-sensing pathway hgl04630   JAK-STAT signaling pathway hgl04650   Natural killer cell mediated cytotoxicity hgl04668   TNF signaling pathway hgl04936   Alcoholic liver disease hgl05135   Yersinia infection hgl05142   Chagas disease hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05171   Coronavirus disease - COVID-19 hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101699042 (Ifnb1)    04668 TNF signaling pathway     101699042 (Ifnb1)    04151 PI3K-Akt signaling pathway     101699042 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101699042 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101699042 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101699042 (Ifnb1)    04621 NOD-like receptor signaling pathway     101699042 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     101699042 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     101699042 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     101699042 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     101699042 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101699042 (Ifnb1)    05161 Hepatitis B     101699042 (Ifnb1)    05160 Hepatitis C     101699042 (Ifnb1)    05171 Coronavirus disease - COVID-19     101699042 (Ifnb1)    05164 Influenza A     101699042 (Ifnb1)    05162 Measles     101699042 (Ifnb1)    05168 Herpes simplex virus 1 infection     101699042 (Ifnb1)    05163 Human cytomegalovirus infection     101699042 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     101699042 (Ifnb1)    05169 Epstein-Barr virus infection     101699042 (Ifnb1)    05165 Human papillomavirus infection     101699042 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     101699042 (Ifnb1)    05152 Tuberculosis     101699042 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     101699042 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101699042 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101699042 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101699042 (Ifnb1) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101699042 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF2779 SesA NYD-SP28 Motif Other DBs NCBI-GeneID:  101699042 NCBI-ProteinID:  XP_004838404 UniProt:  G5CB66 LinkDB All DBs Position Un AA seq 187 aa AA seqDB search MANRCILQIALLLSFSTISLSLSYKLLQAQQRSSSLACGELLKQLKGKPEYCLKDRMDFK FPEEIKQPQHFRKENAALVIQEMLQNILDIVRKNFSNTVWNETIVENLLVELHQQMDSLK TLLQEILEKKDITWEDTMIIPRLKGYYWRIRRHMKAKDNSICAWTVVQVELSRNFSFINR LTDYFQD NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccaacaggtgtatcctccaaatcgctctcctgttgtccttctctaccatatctctt tccttaagctacaaattgcttcaagcccaacaacgcagcagcagtttggcctgtggggag cttttgaagcagttgaaaggaaaacctgaatattgcctcaaggacaggatggatttcaaa ttccctgaggagatcaagcaaccacagcacttccggaaggagaatgctgctcttgtcatc caggagatgctccagaatatcttggatattgtcagaaaaaatttctctaacactgtatgg aatgagaccattgttgagaacctccttgttgaactccatcagcagatggacagtctgaag acactcctgcaggaaatactggagaagaaggacattacctgggaggacaccatgatcatt ccacgcctgaaggggtattattggaggatcaggaggcacatgaaggccaaggacaacagc atttgtgcctggacagtagtccaggtagaactctccaggaacttttccttcattaacaga cttacagattatttccaagactga

Heterocephalus glaber (naked mole-rat): 101699159 Help Entry 101699159         CDS       T02812                                  Symbol Ifnl2 Name (RefSeq) interferon lambda-2   KO K22669   interferon lambda 2/3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101699159 (Ifnl2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101699159 (Ifnl2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101699159 (Ifnl2) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101699159 (Ifnl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL28A Motif Other DBs NCBI-GeneID:  101699159 NCBI-ProteinID:  XP_012932836 LinkDB All DBs Position Un AA seq 160 aa AA seqDB search MSPWEIQAFKEARDNLGHASSVGGGKGPPAEGLLVELPLFPGAWGLQKLQVWECPAALQA ELTLTLEVLDNITNLALEDILKQPLHMLRHIRSQLWACVPAHSALSAPRPHSRLLSQWLQ WLKQATKKESPGCLQASVISNLFCLLTWDLRCVARPDQCA NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtcaccatgggagatccaggccttcaaggaggcgagggataacttgggccatgcctca tccgtgggaggaggaaaaggacctcccgctgaaggactactggtggagctccccctcttc cccggggcctggggcctgcagaagctgcaggtgtgggagtgccctgcggccctgcaggct gagctcaccctgacactggaggtcctggacaacatcaccaacctggccctggaggacatc ctgaagcagcccctccacatgctgcgtcacatccgctcccagctctgggcctgtgtccca gctcacagtgccctctctgcccccaggccccacagtcgcctcctgtcccagtggctgcag tggctcaagcaggccaccaagaaggagtcccctggctgccttcaggcctctgtcatctcc aacctcttctgcctgctcacctgggacctgagatgtgtggccaggccagaccagtgtgcc taa

Heterocephalus glaber (naked mole-rat): 101699626 Help Entry 101699626         CDS       T02812                                  Symbol Ifne Name (RefSeq) interferon epsilon   KO K05442   interferon epsilon Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04622   RIG-I-like receptor signaling pathway hgl04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101699626 (Ifne)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101699626 (Ifne)  09150 Organismal Systems   09151 Immune system    04622 RIG-I-like receptor signaling pathway     101699626 (Ifne)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101699626 (Ifne) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101699626 (Ifne) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF5357 Avian_gp85 Motif Other DBs NCBI-GeneID:  101699626 NCBI-ProteinID:  XP_012925112 LinkDB All DBs Position Un AA seq 124 aa AA seqDB search MIHKQILEILLVLLASSTIFSLELKLAKEHALVILHEMLQQIFKANISLKGWTDNHIEKF LIEHPQQLEYLETLMGLEASRKNGAXGSENLGLQDTAYFXRMINYLENQGYSRCAQTIVQ VEIN NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgattcacaagcagatccttgaaattttgttggtgctgctggcctcttccactattttc tccctagaattgaaactggctaaagaacatgcactggttattcttcatgagatgctacag cagatcttcaaggcaaatatttctttgaaaggttggacggataaccacatagagaaattt ctcatcgaacatcctcagcagctagaatacctagaaacactcatggggttggaagctagt aggaaaaatggtgcctgaggtagtgagaacctggggttacaggatacagcatacttctga aggatgataaattacctggaaaaccaaggatacagtagatgtgcccagaccattgtccag gtggaaatcaactga

Heterocephalus glaber (naked mole-rat): 101700360 Help Entry 101700360         CDS       T02812                                  Symbol Il22 Name (RefSeq) interleukin 22   KO K05445   interleukin 22 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04630   JAK-STAT signaling pathway hgl04659   Th17 cell differentiation hgl05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101700360 (Il22)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101700360 (Il22)  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     101700360 (Il22)  09160 Human Diseases   09163 Immune disease    05321 Inflammatory bowel disease     101700360 (Il22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101700360 (Il22) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101700360 (Il22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL22 IL10 PspAA Motif Other DBs NCBI-GeneID:  101700360 NCBI-ProteinID:  XP_004861143 UniProt:  G5BGB6 LinkDB All DBs Position Un AA seq 178 aa AA seqDB search MAALQKSVSFSILGTLAASCLLLIALSLQGGAAVPVSSHCVLKKSDFSTYITNLTFMLAE EASFADNNTDVRLIGGKLVRGVNVKERCYLMKQVLNFTLEEVLFPHSDWFQPHMKEVVSF LDGLSNKLSPCHIRGDDQHIQRKVEQLKDTVKKLGESGDIKAISEVNLLLSYLKDYCV NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atggctgctctgcagaaatctgtgagcttttccattttggggactctggctgccagttgc ctccttcttattgccctgtcgcttcagggaggagcagctgtgcctgtcagttcccactgt gtgcttaagaagtctgacttctcgacctatatcaccaacctcaccttcatgctcgctgag gaggccagctttgcagataacaacacagatgtccgtctcattggggggaaactggtccga ggagtcaatgtgaaagagcgctgctatctgatgaagcaggtgctgaactttacccttgaa gaagtgctgtttccccactcagactggttccagccccacatgaaggaggtggtgtccttc ctggatggtctcagcaacaaactcagtccatgtcacatcaggggtgatgaccagcatatc cagaggaaggtggaacagctgaaggacacagtgaaaaagcttggagagagtggagacatc aaagcaattagtgaagtgaatttgctgctttcatacctgaaagattactgtgtctga

Heterocephalus glaber (naked mole-rat): 101700722 Help Entry 101700722         CDS       T02812                                  Symbol Ifng Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl03050   Proteasome hgl04060   Cytokine-cytokine receptor interaction hgl04066   HIF-1 signaling pathway hgl04217   Necroptosis hgl04350   TGF-beta signaling pathway hgl04380   Osteoclast differentiation hgl04612   Antigen processing and presentation hgl04630   JAK-STAT signaling pathway hgl04650   Natural killer cell mediated cytotoxicity hgl04657   IL-17 signaling pathway hgl04658   Th1 and Th2 cell differentiation hgl04659   Th17 cell differentiation hgl04660   T cell receptor signaling pathway hgl04940   Type I diabetes mellitus hgl05140   Leishmaniasis hgl05142   Chagas disease hgl05143   African trypanosomiasis hgl05144   Malaria hgl05145   Toxoplasmosis hgl05146   Amoebiasis hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05164   Influenza A hgl05168   Herpes simplex virus 1 infection hgl05200   Pathways in cancer hgl05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hgl05321   Inflammatory bowel disease hgl05322   Systemic lupus erythematosus hgl05323   Rheumatoid arthritis hgl05330   Allograft rejection hgl05332   Graft-versus-host disease hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     101700722 (Ifng)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     101700722 (Ifng)    04630 JAK-STAT signaling pathway     101700722 (Ifng)    04066 HIF-1 signaling pathway     101700722 (Ifng)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101700722 (Ifng)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101700722 (Ifng)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     101700722 (Ifng)    04612 Antigen processing and presentation     101700722 (Ifng)    04660 T cell receptor signaling pathway     101700722 (Ifng)    04658 Th1 and Th2 cell differentiation     101700722 (Ifng)    04659 Th17 cell differentiation     101700722 (Ifng)    04657 IL-17 signaling pathway     101700722 (Ifng)   09158 Development and regeneration    04380 Osteoclast differentiation     101700722 (Ifng)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101700722 (Ifng)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101700722 (Ifng)   09172 Infectious disease: viral    05160 Hepatitis C     101700722 (Ifng)    05164 Influenza A     101700722 (Ifng)    05168 Herpes simplex virus 1 infection     101700722 (Ifng)   09171 Infectious disease: bacterial    05152 Tuberculosis     101700722 (Ifng)   09174 Infectious disease: parasitic    05146 Amoebiasis     101700722 (Ifng)    05144 Malaria     101700722 (Ifng)    05145 Toxoplasmosis     101700722 (Ifng)    05140 Leishmaniasis     101700722 (Ifng)    05142 Chagas disease     101700722 (Ifng)    05143 African trypanosomiasis     101700722 (Ifng)   09163 Immune disease    05322 Systemic lupus erythematosus     101700722 (Ifng)    05323 Rheumatoid arthritis     101700722 (Ifng)    05321 Inflammatory bowel disease     101700722 (Ifng)    05330 Allograft rejection     101700722 (Ifng)    05332 Graft-versus-host disease     101700722 (Ifng)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101700722 (Ifng)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101700722 (Ifng)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:hgl03051]     101700722 (Ifng)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101700722 (Ifng)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101700722 (Ifng) Proteasome [BR:hgl03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     101700722 (Ifng) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101700722 (Ifng) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Cytokines    101700722 (Ifng) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma Motif Other DBs NCBI-GeneID:  101700722 NCBI-ProteinID:  XP_004861144 UniProt:  G5BGB5 LinkDB All DBs Position Un AA seq 164 aa AA seqDB search MKYTSSFLAFQLCIILGFSTYYCESRFTKEINILKDYFNASSSDVGDNGTLFVGILKNCQ EESDKKIFQSQIVSFYFKLFEKSGGNQIVQKSMDTIKEDIIAKFFHSNSSKLDVFQSLTR ISVDNVDFQRRAIIELKKVMDDLSPNQRKRRRSQMLFRGRRASK NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgaagtatacaagttctttcttggcttttcagctctgcatcattttgggtttctctacc tattattgcgagtcaagatttacaaaagaaataaacattctaaaggactattttaacgca agcagctcagatgtaggagataatggaactcttttcgtaggcattttgaagaattgccaa gaggagagtgacaaaaaaatatttcagagccaaattgtctccttctacttcaaactcttt gaaaaatccggaggcaaccagattgtccaaaagagcatggacaccatcaaggaagacatc atcgctaagttcttccacagcaacagcagcaaactggacgtcttccaaagcctgactcga atttcagtagataatgtggatttccagcgccgagccatcattgaactcaaaaaagtgatg gatgatctgtctccgaaccagcggaaacgaagaaggagtcagatgttgtttcggggccgg agagcatctaaataa

Heterocephalus glaber (naked mole-rat): 101701309 Help Entry 101701309         CDS       T02812                                  Symbol Il12b Name (RefSeq) interleukin 12B   KO K05425   interleukin 12B Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04620   Toll-like receptor signaling pathway hgl04622   RIG-I-like receptor signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl04658   Th1 and Th2 cell differentiation hgl04936   Alcoholic liver disease hgl04940   Type I diabetes mellitus hgl05133   Pertussis hgl05134   Legionellosis hgl05140   Leishmaniasis hgl05142   Chagas disease hgl05143   African trypanosomiasis hgl05145   Toxoplasmosis hgl05146   Amoebiasis hgl05152   Tuberculosis hgl05162   Measles hgl05164   Influenza A hgl05168   Herpes simplex virus 1 infection hgl05171   Coronavirus disease - COVID-19 hgl05200   Pathways in cancer hgl05205   Proteoglycans in cancer hgl05321   Inflammatory bowel disease hgl05330   Allograft rejection hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101701309 (Il12b)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101701309 (Il12b)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101701309 (Il12b)    04622 RIG-I-like receptor signaling pathway     101701309 (Il12b)    04625 C-type lectin receptor signaling pathway     101701309 (Il12b)    04658 Th1 and Th2 cell differentiation     101701309 (Il12b)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101701309 (Il12b)    05205 Proteoglycans in cancer     101701309 (Il12b)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101701309 (Il12b)    05164 Influenza A     101701309 (Il12b)    05162 Measles     101701309 (Il12b)    05168 Herpes simplex virus 1 infection     101701309 (Il12b)   09171 Infectious disease: bacterial    05133 Pertussis     101701309 (Il12b)    05134 Legionellosis     101701309 (Il12b)    05152 Tuberculosis     101701309 (Il12b)   09174 Infectious disease: parasitic    05146 Amoebiasis     101701309 (Il12b)    05145 Toxoplasmosis     101701309 (Il12b)    05140 Leishmaniasis     101701309 (Il12b)    05142 Chagas disease     101701309 (Il12b)    05143 African trypanosomiasis     101701309 (Il12b)   09163 Immune disease    05321 Inflammatory bowel disease     101701309 (Il12b)    05330 Allograft rejection     101701309 (Il12b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101701309 (Il12b)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101701309 (Il12b)    04936 Alcoholic liver disease     101701309 (Il12b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101701309 (Il12b)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101701309 (Il12b) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101701309 (Il12b) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Cytokines    101701309 (Il12b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12p40_C Ig_5 Ig_3 Ig_2 fn3 Ig_4 ig Motif Other DBs NCBI-GeneID:  101701309 NCBI-ProteinID:  XP_004836527 UniProt:  G5BEN1 LinkDB All DBs Position Un AA seq 329 aa AA seqDB search MCHRQLITSWFSLVMLVSPLVAIWELEKDVYVVELDWHPDAPGEMVVLTCDTAEEDGITW TSDQSGDVLGSGKNLTIQVKEFRDAGRYTCHKGVEVLSHLLLLLHKKEDGIWSTDILKDQ KEPKSKTFLKCEATSYSGCFTCWWLTAISTDVTFSVKGSRGSSEPSGVTCGAATLSAERV RVDHREYKKYSVECQEDSTCPAAEERLPIEVVVDAIHKLKYEKYTSSFYIRDIIKPDPPK NLQLKPLMNSHQVEVSWEYPDTWSTPHSYFSLTFAVQVHGKNKKEKKDRLSTDKTSATVS CHKNAKVYVQARDRYYSSSWSEWASVSCS NT seq 990 nt NT seq  +upstreamnt  +downstreamnt atgtgtcatcggcagttgatcacctcctggttttccctggtgatgctagtgtctcctctc gtggccatatgggaactggagaaagatgtttacgtcgtggagttggactggcaccctgat gctcctggagagatggtagttctcacctgtgacactgctgaggaagatggcatcacatgg acctcagaccagagtggtgatgtcttaggctctggtaaaaacctgaccatccaagtgaaa gagttcagagacgccggacggtacacttgtcacaaaggagtcgaggttctgagccatttg ctcctgctacttcacaaaaaggaggatggaatttggtccactgatattttaaaggaccag aaagaacccaaaagcaagacctttctgaaatgtgaggcaacaagttattctggatgtttc acctgctggtggctgacagcaatcagtactgatgtgacattcagtgtcaagggcagcaga ggctcctctgagccttcaggagtgacttgtggagcagcaacactgtccgcagagagggtc agagtggaccacagggagtataagaagtactcagtagagtgccaggaggacagcacctgc cccgccgcagaggagaggctacccattgaggtggtggtggacgctattcacaagctcaag tatgaaaagtataccagcagcttctacatcagagacatcatcaagccagacccaccgaag aacctgcagctgaagccattaatgaattctcatcaggtggaggtcagctgggagtatcct gacacctggagcactccacattcctacttctccctgacgtttgcagttcaggtccacggc aagaataagaaagaaaagaaagatagactctccaccgacaagacctcagccacagtttca tgccacaagaatgcgaaggtgtacgtgcaagcccgggaccgatactatagctcatcttgg agcgaatgggcctctgtgtcctgcagttag

Heterocephalus glaber (naked mole-rat): 101701392 Help Entry 101701392         CDS       T02812                                  Symbol Il12a Name (RefSeq) interleukin 12A   KO K05406   interleukin 12A Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04620   Toll-like receptor signaling pathway hgl04622   RIG-I-like receptor signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl04658   Th1 and Th2 cell differentiation hgl04936   Alcoholic liver disease hgl04940   Type I diabetes mellitus hgl05133   Pertussis hgl05134   Legionellosis hgl05140   Leishmaniasis hgl05142   Chagas disease hgl05143   African trypanosomiasis hgl05144   Malaria hgl05145   Toxoplasmosis hgl05146   Amoebiasis hgl05152   Tuberculosis hgl05162   Measles hgl05164   Influenza A hgl05168   Herpes simplex virus 1 infection hgl05171   Coronavirus disease - COVID-19 hgl05200   Pathways in cancer hgl05321   Inflammatory bowel disease hgl05330   Allograft rejection hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101701392 (Il12a)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101701392 (Il12a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101701392 (Il12a)    04622 RIG-I-like receptor signaling pathway     101701392 (Il12a)    04625 C-type lectin receptor signaling pathway     101701392 (Il12a)    04658 Th1 and Th2 cell differentiation     101701392 (Il12a)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101701392 (Il12a)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101701392 (Il12a)    05164 Influenza A     101701392 (Il12a)    05162 Measles     101701392 (Il12a)    05168 Herpes simplex virus 1 infection     101701392 (Il12a)   09171 Infectious disease: bacterial    05133 Pertussis     101701392 (Il12a)    05134 Legionellosis     101701392 (Il12a)    05152 Tuberculosis     101701392 (Il12a)   09174 Infectious disease: parasitic    05146 Amoebiasis     101701392 (Il12a)    05144 Malaria     101701392 (Il12a)    05145 Toxoplasmosis     101701392 (Il12a)    05140 Leishmaniasis     101701392 (Il12a)    05142 Chagas disease     101701392 (Il12a)    05143 African trypanosomiasis     101701392 (Il12a)   09163 Immune disease    05321 Inflammatory bowel disease     101701392 (Il12a)    05330 Allograft rejection     101701392 (Il12a)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101701392 (Il12a)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101701392 (Il12a)    04936 Alcoholic liver disease     101701392 (Il12a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101701392 (Il12a)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101701392 (Il12a) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101701392 (Il12a) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Cytokines    101701392 (Il12a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  101701392 NCBI-ProteinID:  XP_004834586 UniProt:  A0AAX6NQH1 LinkDB All DBs Position Un AA seq 219 aa AA seqDB search MGPSLSFLLLATIVLPVHLSWARSLPRATTVRETFQCLNHSQTLLSAVSSTLQKARQTLE FYSCTPEELDHEDITKDKTSTVKACVPLELVKNESCLASGHTSFITNGSCLTSRKTSFLM TLCLNSIYEDLKLYQLEFKAMNAKLLMDPNRQIFLDQNMLSAIDELMQALNVNSETVPQK PSSEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atgggtccttcgctcagcttcctacttttggccaccattgtcctcccagtccatctcagt tgggccaggagcctccctagggccacaacggtcagagaaacgttccagtgccttaaccac tcccaaaccctgctgagcgcagtgagcagcacgcttcaaaaggccagacaaaccctagaa ttttactcctgtactcctgaagagttggatcatgaagatatcacaaaagacaaaaccagc acagtgaaagcctgtgtgccactggaactagtcaagaatgagagctgcctggcttctgga catacttctttcataactaatgggagttgcctgacttccagaaagacctcgtttttgatg accctgtgccttaatagtatctatgaggacttgaaactgtaccagctggagttcaaggcc atgaatgcaaagcttttgatggatcctaacaggcagatctttctagatcaaaacatgctt tcagctattgatgagttgatgcaggccctgaatgtcaacagtgagactgtgccacaaaaa ccttcctctgaagaaccagatttttataaaactaaaatcaagctctgcatacttcttcat gctttcagaattcgtgcagtcactatcgacagaatgatgagttatctgaattcttcctaa

DBGET integrated database retrieval system