KEGG   Heterocephalus glaber (naked mole rat): 101697163
Entry
101697163         CDS       T02812                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04217  Necroptosis
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04623  Cytosolic DNA-sensing pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101697163
   04151 PI3K-Akt signaling pathway
    101697163
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101697163
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101697163
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101697163
   04621 NOD-like receptor signaling pathway
    101697163
   04622 RIG-I-like receptor signaling pathway
    101697163
   04623 Cytosolic DNA-sensing pathway
    101697163
   04650 Natural killer cell mediated cytotoxicity
    101697163
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101697163
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101697163
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101697163
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101697163
   05161 Hepatitis B
    101697163
   05160 Hepatitis C
    101697163
   05171 Coronavirus disease - COVID-19
    101697163
   05164 Influenza A
    101697163
   05162 Measles
    101697163
   05168 Herpes simplex virus 1 infection
    101697163
   05163 Human cytomegalovirus infection
    101697163
   05167 Kaposi sarcoma-associated herpesvirus infection
    101697163
   05169 Epstein-Barr virus infection
    101697163
   05165 Human papillomavirus infection
    101697163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101697163
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101697163
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 101697163
NCBI-ProteinID: XP_004875569
LinkDB
Position
Un
AA seq 187 aa
MAWPLSVLVALVVLTIMSSCSLGCDLPRTHSQGNRRALTLLEQMRRISTFSCLKDREDFG
LPHQEFDGKQIQKAQAISVLHEMTSQTFNLFSTQDSSAAWNNGLLDTFCTGLHQQLSDLE
ACLTQEVGQEEAPISHEDSRLAVRKYFHRITLYLKEKRYSPCAWEVVRAEIMRSFSSSEK
LARKVKD
NT seq 564 nt   +upstreamnt  +downstreamnt
atggcctggccactttctgtactggtggccctggtggtgctcaccatcatgtcatcgtgc
tctctgggctgtgacctgcctcgaacccacagccaggggaacaggagggccttgacacta
ctggaacaaatgaggagaatctccactttctcctgcctgaaggacagagaggactttggc
ctcccccaccaggagtttgatggcaaacagatccagaaggctcaggccatctctgtcctc
catgagatgaccagccagaccttcaacctcttcagcacacaggattcatctgccgcctgg
aacaatggcctgctggacaccttctgcaccggcctccatcagcagctgagtgatctggag
gcctgcctgacccaggaggtggggcaggaagaggcgcccatctcgcatgaggactccaga
ctggctgtgaggaaatacttccacaggatcactctctacctgaaggagaagcgatacagc
ccttgtgcctgggaagttgtcagagcagaaatcatgagatccttctcttcatcggagaaa
cttgcaagaaaggtgaaagactaa

KEGG   Heterocephalus glaber (naked mole rat): 101697684
Entry
101697684         CDS       T02812                                 

Gene name
Ifnl3
Definition
(RefSeq) interferon lambda 3
  KO
K22669  interferon lambda 2/3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101697684 (Ifnl3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101697684 (Ifnl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101697684 (Ifnl3)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101697684 (Ifnl3)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 101697684
NCBI-ProteinID: XP_004859222
LinkDB
Position
Un
AA seq 171 aa
MKPDPAGGCVLLLLLLLCTVQTRSGEVPVPRPLSVSPDARGCHVAQLQSLSLEERQAFKT
AKEALEERRLLKDSTCNSGLFFRAWDLGKLQVWERPMALQAELSLTLKVLASVTDQALWG
IVKQPIHTLRHIHAQLRACESPGCLQASVTFNLFRLLTRDLRCVARPDLCA
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaagccagaccccgctggaggttgcgtgctgctgctgctgctgctgctgtgcactgta
cagaccaggtcaggggaagttcctgtccccagacccctcagtgtctccccggatgcaagg
ggctgccacgtggcccagttgcaatctctgtccctagaagagaggcaggccttcaagaca
gccaaggaagcattggaagagcggcgcctgctgaaggactccacctgcaactcggggctc
ttcttcagggcctgggacctggggaagcttcaagtgtgggagcgccccatggccctgcag
gctgagctctccctgacactgaaggtcttggcctcggtgacagaccaggccctgtggggc
atcgtgaagcagccgattcacactctgcgtcacatccacgcccagctccgggcctgtgag
tcccctggctgcctccaggcctctgtcaccttcaacctcttccgcctgctcacccgggac
ctgagatgtgtggccaggccagacctgtgtgcctga

KEGG   Heterocephalus glaber (naked mole rat): 101698799
Entry
101698799         CDS       T02812                                 

Definition
(RefSeq) interferon lambda-2-like
  KO
K22669  interferon lambda 2/3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101698799
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101698799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101698799
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101698799
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 101698799
NCBI-ProteinID: XP_012932835
LinkDB
Position
Un
AA seq 200 aa
MKPDPAGGCVLLLLLLLCTVQTRSGEVPVPRPLSVSPDARGCHVAQLQSLSLEERQAFKT
AKEALEERRLLKDSTCNSGLFFRAWDLGKLQVWERPMALQAELSLTLKVLASVTDQALWG
IVKQPIHTLRHIHAQLRACVPAQPKAAHRPCSHRLSRWLQRLNQATKKESPGCLQASVIS
NLFFLLTRDLRCLARPDLCA
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaagccagaccccgctggaggttgcgtgctgctgctgctgctgctgctgtgcactgta
cagaccaggtcaggggaagttcctgtccccagacccctcagtgtctccccggatgcaagg
ggctgccacgtggcccagttgcaatctctgtccctagaagagaggcaggccttcaagaca
gccaaggaagcattggaagagcggcgcctgctgaaggactccacctgcaactcggggctc
ttcttcagggcctgggacctagggaagcttcaagtgtgggagcgccccatggccctgcag
gctgagctctccctgacactgaaggtcttggcctcggtgacagaccaggccctgtggggc
atcgtgaagcagccgattcacactctgcgtcacatccacgcccagctccgggcctgtgtc
ccagctcagcccaaagcagcccacaggccctgcagccaccgcctgtcccgatggctgcag
cggctcaaccaggccaccaagaaggagtcccctggctgcctccaggcctctgtcatctcc
aacctcttcttcctgctcacccgggacctgagatgtttggccaggccagacctgtgtgcc
tga

KEGG   Heterocephalus glaber (naked mole rat): 101699042
Entry
101699042         CDS       T02812                                 

Gene name
Ifnb1
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04623  Cytosolic DNA-sensing pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04668  TNF signaling pathway
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101699042 (Ifnb1)
   04668 TNF signaling pathway
    101699042 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    101699042 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101699042 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101699042 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101699042 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    101699042 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    101699042 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    101699042 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    101699042 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101699042 (Ifnb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101699042 (Ifnb1)
   05152 Tuberculosis
    101699042 (Ifnb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101699042 (Ifnb1)
   05161 Hepatitis B
    101699042 (Ifnb1)
   05160 Hepatitis C
    101699042 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    101699042 (Ifnb1)
   05164 Influenza A
    101699042 (Ifnb1)
   05162 Measles
    101699042 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    101699042 (Ifnb1)
   05163 Human cytomegalovirus infection
    101699042 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101699042 (Ifnb1)
   05169 Epstein-Barr virus infection
    101699042 (Ifnb1)
   05165 Human papillomavirus infection
    101699042 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101699042 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101699042 (Ifnb1)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101699042 (Ifnb1)
SSDB
Motif
Pfam: Interferon NYD-SP28 DUF2779 GAT
Other DBs
NCBI-GeneID: 101699042
NCBI-ProteinID: XP_004838404
UniProt: G5CB66
LinkDB
Position
Un
AA seq 187 aa
MANRCILQIALLLSFSTISLSLSYKLLQAQQRSSSLACGELLKQLKGKPEYCLKDRMDFK
FPEEIKQPQHFRKENAALVIQEMLQNILDIVRKNFSNTVWNETIVENLLVELHQQMDSLK
TLLQEILEKKDITWEDTMIIPRLKGYYWRIRRHMKAKDNSICAWTVVQVELSRNFSFINR
LTDYFQD
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccaacaggtgtatcctccaaatcgctctcctgttgtccttctctaccatatctctt
tccttaagctacaaattgcttcaagcccaacaacgcagcagcagtttggcctgtggggag
cttttgaagcagttgaaaggaaaacctgaatattgcctcaaggacaggatggatttcaaa
ttccctgaggagatcaagcaaccacagcacttccggaaggagaatgctgctcttgtcatc
caggagatgctccagaatatcttggatattgtcagaaaaaatttctctaacactgtatgg
aatgagaccattgttgagaacctccttgttgaactccatcagcagatggacagtctgaag
acactcctgcaggaaatactggagaagaaggacattacctgggaggacaccatgatcatt
ccacgcctgaaggggtattattggaggatcaggaggcacatgaaggccaaggacaacagc
atttgtgcctggacagtagtccaggtagaactctccaggaacttttccttcattaacaga
cttacagattatttccaagactga

KEGG   Heterocephalus glaber (naked mole rat): 101699159
Entry
101699159         CDS       T02812                                 

Gene name
Ifnl2
Definition
(RefSeq) interferon lambda-2
  KO
K22669  interferon lambda 2/3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101699159 (Ifnl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101699159 (Ifnl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101699159 (Ifnl2)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101699159 (Ifnl2)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 101699159
NCBI-ProteinID: XP_012932836
LinkDB
Position
Un
AA seq 160 aa
MSPWEIQAFKEARDNLGHASSVGGGKGPPAEGLLVELPLFPGAWGLQKLQVWECPAALQA
ELTLTLEVLDNITNLALEDILKQPLHMLRHIRSQLWACVPAHSALSAPRPHSRLLSQWLQ
WLKQATKKESPGCLQASVISNLFCLLTWDLRCVARPDQCA
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtcaccatgggagatccaggccttcaaggaggcgagggataacttgggccatgcctca
tccgtgggaggaggaaaaggacctcccgctgaaggactactggtggagctccccctcttc
cccggggcctggggcctgcagaagctgcaggtgtgggagtgccctgcggccctgcaggct
gagctcaccctgacactggaggtcctggacaacatcaccaacctggccctggaggacatc
ctgaagcagcccctccacatgctgcgtcacatccgctcccagctctgggcctgtgtccca
gctcacagtgccctctctgcccccaggccccacagtcgcctcctgtcccagtggctgcag
tggctcaagcaggccaccaagaaggagtcccctggctgccttcaggcctctgtcatctcc
aacctcttctgcctgctcacctgggacctgagatgtgtggccaggccagaccagtgtgcc
taa

KEGG   Heterocephalus glaber (naked mole rat): 101699626
Entry
101699626         CDS       T02812                                 

Gene name
Ifne
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04622  RIG-I-like receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101699626 (Ifne)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101699626 (Ifne)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101699626 (Ifne)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101699626 (Ifne)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101699626 (Ifne)
SSDB
Motif
Pfam: Interferon DUF5357 Avian_gp85
Other DBs
NCBI-GeneID: 101699626
NCBI-ProteinID: XP_012925112
LinkDB
Position
Un
AA seq 124 aa
MIHKQILEILLVLLASSTIFSLELKLAKEHALVILHEMLQQIFKANISLKGWTDNHIEKF
LIEHPQQLEYLETLMGLEASRKNGAXGSENLGLQDTAYFXRMINYLENQGYSRCAQTIVQ
VEIN
NT seq 375 nt   +upstreamnt  +downstreamnt
atgattcacaagcagatccttgaaattttgttggtgctgctggcctcttccactattttc
tccctagaattgaaactggctaaagaacatgcactggttattcttcatgagatgctacag
cagatcttcaaggcaaatatttctttgaaaggttggacggataaccacatagagaaattt
ctcatcgaacatcctcagcagctagaatacctagaaacactcatggggttggaagctagt
aggaaaaatggtgcctgaggtagtgagaacctggggttacaggatacagcatacttctga
aggatgataaattacctggaaaaccaaggatacagtagatgtgcccagaccattgtccag
gtggaaatcaactga

KEGG   Heterocephalus glaber (naked mole rat): 101700360
Entry
101700360         CDS       T02812                                 

Gene name
Il22
Definition
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101700360 (Il22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101700360 (Il22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101700360 (Il22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101700360 (Il22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101700360 (Il22)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101700360 (Il22)
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 101700360
NCBI-ProteinID: XP_004861143
UniProt: G5BGB6
LinkDB
Position
Un
AA seq 178 aa
MAALQKSVSFSILGTLAASCLLLIALSLQGGAAVPVSSHCVLKKSDFSTYITNLTFMLAE
EASFADNNTDVRLIGGKLVRGVNVKERCYLMKQVLNFTLEEVLFPHSDWFQPHMKEVVSF
LDGLSNKLSPCHIRGDDQHIQRKVEQLKDTVKKLGESGDIKAISEVNLLLSYLKDYCV
NT seq 537 nt   +upstreamnt  +downstreamnt
atggctgctctgcagaaatctgtgagcttttccattttggggactctggctgccagttgc
ctccttcttattgccctgtcgcttcagggaggagcagctgtgcctgtcagttcccactgt
gtgcttaagaagtctgacttctcgacctatatcaccaacctcaccttcatgctcgctgag
gaggccagctttgcagataacaacacagatgtccgtctcattggggggaaactggtccga
ggagtcaatgtgaaagagcgctgctatctgatgaagcaggtgctgaactttacccttgaa
gaagtgctgtttccccactcagactggttccagccccacatgaaggaggtggtgtccttc
ctggatggtctcagcaacaaactcagtccatgtcacatcaggggtgatgaccagcatatc
cagaggaaggtggaacagctgaaggacacagtgaaaaagcttggagagagtggagacatc
aaagcaattagtgaagtgaatttgctgctttcatacctgaaagattactgtgtctga

KEGG   Heterocephalus glaber (naked mole rat): 101700722
Entry
101700722         CDS       T02812                                 

Gene name
Ifng
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03050  Proteasome
hgl04060  Cytokine-cytokine receptor interaction
hgl04066  HIF-1 signaling pathway
hgl04217  Necroptosis
hgl04350  TGF-beta signaling pathway
hgl04380  Osteoclast differentiation
hgl04612  Antigen processing and presentation
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04940  Type I diabetes mellitus
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05143  African trypanosomiasis
hgl05144  Malaria
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05164  Influenza A
hgl05168  Herpes simplex virus 1 infection
hgl05200  Pathways in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05321  Inflammatory bowel disease
hgl05322  Systemic lupus erythematosus
hgl05323  Rheumatoid arthritis
hgl05330  Allograft rejection
hgl05332  Graft-versus-host disease
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101700722 (Ifng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101700722 (Ifng)
   04630 JAK-STAT signaling pathway
    101700722 (Ifng)
   04066 HIF-1 signaling pathway
    101700722 (Ifng)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101700722 (Ifng)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101700722 (Ifng)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101700722 (Ifng)
   04612 Antigen processing and presentation
    101700722 (Ifng)
   04660 T cell receptor signaling pathway
    101700722 (Ifng)
   04658 Th1 and Th2 cell differentiation
    101700722 (Ifng)
   04659 Th17 cell differentiation
    101700722 (Ifng)
   04657 IL-17 signaling pathway
    101700722 (Ifng)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101700722 (Ifng)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101700722 (Ifng)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101700722 (Ifng)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101700722 (Ifng)
   05323 Rheumatoid arthritis
    101700722 (Ifng)
   05321 Inflammatory bowel disease
    101700722 (Ifng)
   05330 Allograft rejection
    101700722 (Ifng)
   05332 Graft-versus-host disease
    101700722 (Ifng)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101700722 (Ifng)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101700722 (Ifng)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101700722 (Ifng)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101700722 (Ifng)
   05164 Influenza A
    101700722 (Ifng)
   05168 Herpes simplex virus 1 infection
    101700722 (Ifng)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101700722 (Ifng)
   05144 Malaria
    101700722 (Ifng)
   05145 Toxoplasmosis
    101700722 (Ifng)
   05140 Leishmaniasis
    101700722 (Ifng)
   05142 Chagas disease
    101700722 (Ifng)
   05143 African trypanosomiasis
    101700722 (Ifng)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hgl03051]
    101700722 (Ifng)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101700722 (Ifng)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101700722 (Ifng)
Proteasome [BR:hgl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101700722 (Ifng)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101700722 (Ifng)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101700722 (Ifng)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 101700722
NCBI-ProteinID: XP_004861144
UniProt: G5BGB5
LinkDB
Position
Un
AA seq 164 aa
MKYTSSFLAFQLCIILGFSTYYCESRFTKEINILKDYFNASSSDVGDNGTLFVGILKNCQ
EESDKKIFQSQIVSFYFKLFEKSGGNQIVQKSMDTIKEDIIAKFFHSNSSKLDVFQSLTR
ISVDNVDFQRRAIIELKKVMDDLSPNQRKRRRSQMLFRGRRASK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaagtatacaagttctttcttggcttttcagctctgcatcattttgggtttctctacc
tattattgcgagtcaagatttacaaaagaaataaacattctaaaggactattttaacgca
agcagctcagatgtaggagataatggaactcttttcgtaggcattttgaagaattgccaa
gaggagagtgacaaaaaaatatttcagagccaaattgtctccttctacttcaaactcttt
gaaaaatccggaggcaaccagattgtccaaaagagcatggacaccatcaaggaagacatc
atcgctaagttcttccacagcaacagcagcaaactggacgtcttccaaagcctgactcga
atttcagtagataatgtggatttccagcgccgagccatcattgaactcaaaaaagtgatg
gatgatctgtctccgaaccagcggaaacgaagaaggagtcagatgttgtttcggggccgg
agagcatctaaataa

KEGG   Heterocephalus glaber (naked mole rat): 101701309
Entry
101701309         CDS       T02812                                 

Gene name
Il12b
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04620  Toll-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04940  Type I diabetes mellitus
hgl05133  Pertussis
hgl05134  Legionellosis
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05143  African trypanosomiasis
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05162  Measles
hgl05164  Influenza A
hgl05168  Herpes simplex virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05321  Inflammatory bowel disease
hgl05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101701309 (Il12b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101701309 (Il12b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101701309 (Il12b)
   04622 RIG-I-like receptor signaling pathway
    101701309 (Il12b)
   04625 C-type lectin receptor signaling pathway
    101701309 (Il12b)
   04658 Th1 and Th2 cell differentiation
    101701309 (Il12b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101701309 (Il12b)
   05205 Proteoglycans in cancer
    101701309 (Il12b)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101701309 (Il12b)
   05330 Allograft rejection
    101701309 (Il12b)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101701309 (Il12b)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101701309 (Il12b)
   05134 Legionellosis
    101701309 (Il12b)
   05152 Tuberculosis
    101701309 (Il12b)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101701309 (Il12b)
   05164 Influenza A
    101701309 (Il12b)
   05162 Measles
    101701309 (Il12b)
   05168 Herpes simplex virus 1 infection
    101701309 (Il12b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101701309 (Il12b)
   05145 Toxoplasmosis
    101701309 (Il12b)
   05140 Leishmaniasis
    101701309 (Il12b)
   05142 Chagas disease
    101701309 (Il12b)
   05143 African trypanosomiasis
    101701309 (Il12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101701309 (Il12b)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101701309 (Il12b)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101701309 (Il12b)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101701309 (Il12b)
SSDB
Motif
Pfam: IL12p40_C fn3 Ig_5 Ig_3 Ig_2 Ig_4
Other DBs
NCBI-GeneID: 101701309
NCBI-ProteinID: XP_004836527
UniProt: G5BEN1
LinkDB
Position
Un
AA seq 329 aa
MCHRQLITSWFSLVMLVSPLVAIWELEKDVYVVELDWHPDAPGEMVVLTCDTAEEDGITW
TSDQSGDVLGSGKNLTIQVKEFRDAGRYTCHKGVEVLSHLLLLLHKKEDGIWSTDILKDQ
KEPKSKTFLKCEATSYSGCFTCWWLTAISTDVTFSVKGSRGSSEPSGVTCGAATLSAERV
RVDHREYKKYSVECQEDSTCPAAEERLPIEVVVDAIHKLKYEKYTSSFYIRDIIKPDPPK
NLQLKPLMNSHQVEVSWEYPDTWSTPHSYFSLTFAVQVHGKNKKEKKDRLSTDKTSATVS
CHKNAKVYVQARDRYYSSSWSEWASVSCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtgtcatcggcagttgatcacctcctggttttccctggtgatgctagtgtctcctctc
gtggccatatgggaactggagaaagatgtttacgtcgtggagttggactggcaccctgat
gctcctggagagatggtagttctcacctgtgacactgctgaggaagatggcatcacatgg
acctcagaccagagtggtgatgtcttaggctctggtaaaaacctgaccatccaagtgaaa
gagttcagagacgccggacggtacacttgtcacaaaggagtcgaggttctgagccatttg
ctcctgctacttcacaaaaaggaggatggaatttggtccactgatattttaaaggaccag
aaagaacccaaaagcaagacctttctgaaatgtgaggcaacaagttattctggatgtttc
acctgctggtggctgacagcaatcagtactgatgtgacattcagtgtcaagggcagcaga
ggctcctctgagccttcaggagtgacttgtggagcagcaacactgtccgcagagagggtc
agagtggaccacagggagtataagaagtactcagtagagtgccaggaggacagcacctgc
cccgccgcagaggagaggctacccattgaggtggtggtggacgctattcacaagctcaag
tatgaaaagtataccagcagcttctacatcagagacatcatcaagccagacccaccgaag
aacctgcagctgaagccattaatgaattctcatcaggtggaggtcagctgggagtatcct
gacacctggagcactccacattcctacttctccctgacgtttgcagttcaggtccacggc
aagaataagaaagaaaagaaagatagactctccaccgacaagacctcagccacagtttca
tgccacaagaatgcgaaggtgtacgtgcaagcccgggaccgatactatagctcatcttgg
agcgaatgggcctctgtgtcctgcagttag

KEGG   Heterocephalus glaber (naked mole rat): 101701392
Entry
101701392         CDS       T02812                                 

Gene name
Il12a
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04620  Toll-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04940  Type I diabetes mellitus
hgl05133  Pertussis
hgl05134  Legionellosis
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05143  African trypanosomiasis
hgl05144  Malaria
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05162  Measles
hgl05164  Influenza A
hgl05168  Herpes simplex virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
hgl05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101701392 (Il12a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101701392 (Il12a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101701392 (Il12a)
   04622 RIG-I-like receptor signaling pathway
    101701392 (Il12a)
   04625 C-type lectin receptor signaling pathway
    101701392 (Il12a)
   04658 Th1 and Th2 cell differentiation
    101701392 (Il12a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101701392 (Il12a)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101701392 (Il12a)
   05330 Allograft rejection
    101701392 (Il12a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101701392 (Il12a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101701392 (Il12a)
   05134 Legionellosis
    101701392 (Il12a)
   05152 Tuberculosis
    101701392 (Il12a)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101701392 (Il12a)
   05164 Influenza A
    101701392 (Il12a)
   05162 Measles
    101701392 (Il12a)
   05168 Herpes simplex virus 1 infection
    101701392 (Il12a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101701392 (Il12a)
   05144 Malaria
    101701392 (Il12a)
   05145 Toxoplasmosis
    101701392 (Il12a)
   05140 Leishmaniasis
    101701392 (Il12a)
   05142 Chagas disease
    101701392 (Il12a)
   05143 African trypanosomiasis
    101701392 (Il12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101701392 (Il12a)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101701392 (Il12a)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101701392 (Il12a)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101701392 (Il12a)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 101701392
NCBI-ProteinID: XP_004834586
LinkDB
Position
Un
AA seq 219 aa
MGPSLSFLLLATIVLPVHLSWARSLPRATTVRETFQCLNHSQTLLSAVSSTLQKARQTLE
FYSCTPEELDHEDITKDKTSTVKACVPLELVKNESCLASGHTSFITNGSCLTSRKTSFLM
TLCLNSIYEDLKLYQLEFKAMNAKLLMDPNRQIFLDQNMLSAIDELMQALNVNSETVPQK
PSSEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS
NT seq 660 nt   +upstreamnt  +downstreamnt
atgggtccttcgctcagcttcctacttttggccaccattgtcctcccagtccatctcagt
tgggccaggagcctccctagggccacaacggtcagagaaacgttccagtgccttaaccac
tcccaaaccctgctgagcgcagtgagcagcacgcttcaaaaggccagacaaaccctagaa
ttttactcctgtactcctgaagagttggatcatgaagatatcacaaaagacaaaaccagc
acagtgaaagcctgtgtgccactggaactagtcaagaatgagagctgcctggcttctgga
catacttctttcataactaatgggagttgcctgacttccagaaagacctcgtttttgatg
accctgtgccttaatagtatctatgaggacttgaaactgtaccagctggagttcaaggcc
atgaatgcaaagcttttgatggatcctaacaggcagatctttctagatcaaaacatgctt
tcagctattgatgagttgatgcaggccctgaatgtcaacagtgagactgtgccacaaaaa
ccttcctctgaagaaccagatttttataaaactaaaatcaagctctgcatacttcttcat
gctttcagaattcgtgcagtcactatcgacagaatgatgagttatctgaattcttcctaa

KEGG   Heterocephalus glaber (naked mole rat): 101702602
Entry
101702602         CDS       T02812                                 

Gene name
Il6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01523  Antifolate resistance
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04218  Cellular senescence
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04623  Cytosolic DNA-sensing pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04657  IL-17 signaling pathway
hgl04659  Th17 cell differentiation
hgl04668  TNF signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05010  Alzheimer disease
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05132  Salmonella infection
hgl05133  Pertussis
hgl05134  Legionellosis
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05143  African trypanosomiasis
hgl05144  Malaria
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05321  Inflammatory bowel disease
hgl05323  Rheumatoid arthritis
hgl05332  Graft-versus-host disease
hgl05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101702602 (Il6)
   04668 TNF signaling pathway
    101702602 (Il6)
   04066 HIF-1 signaling pathway
    101702602 (Il6)
   04068 FoxO signaling pathway
    101702602 (Il6)
   04151 PI3K-Akt signaling pathway
    101702602 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101702602 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101702602 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101702602 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101702602 (Il6)
   04620 Toll-like receptor signaling pathway
    101702602 (Il6)
   04621 NOD-like receptor signaling pathway
    101702602 (Il6)
   04623 Cytosolic DNA-sensing pathway
    101702602 (Il6)
   04625 C-type lectin receptor signaling pathway
    101702602 (Il6)
   04659 Th17 cell differentiation
    101702602 (Il6)
   04657 IL-17 signaling pathway
    101702602 (Il6)
   04672 Intestinal immune network for IgA production
    101702602 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101702602 (Il6)
   05202 Transcriptional misregulation in cancer
    101702602 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101702602 (Il6)
   05321 Inflammatory bowel disease
    101702602 (Il6)
   05332 Graft-versus-host disease
    101702602 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101702602 (Il6)
   05020 Prion disease
    101702602 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    101702602 (Il6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101702602 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101702602 (Il6)
   04931 Insulin resistance
    101702602 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101702602 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101702602 (Il6)
   05135 Yersinia infection
    101702602 (Il6)
   05133 Pertussis
    101702602 (Il6)
   05134 Legionellosis
    101702602 (Il6)
   05152 Tuberculosis
    101702602 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101702602 (Il6)
   05161 Hepatitis B
    101702602 (Il6)
   05171 Coronavirus disease - COVID-19
    101702602 (Il6)
   05164 Influenza A
    101702602 (Il6)
   05162 Measles
    101702602 (Il6)
   05168 Herpes simplex virus 1 infection
    101702602 (Il6)
   05163 Human cytomegalovirus infection
    101702602 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101702602 (Il6)
   05169 Epstein-Barr virus infection
    101702602 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101702602 (Il6)
   05144 Malaria
    101702602 (Il6)
   05142 Chagas disease
    101702602 (Il6)
   05143 African trypanosomiasis
    101702602 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101702602 (Il6)
   01523 Antifolate resistance
    101702602 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101702602 (Il6)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101702602 (Il6)
SSDB
Motif
Pfam: IL6 IL23 CENP_C_N
Other DBs
NCBI-GeneID: 101702602
NCBI-ProteinID: XP_004839876
LinkDB
Position
Un
AA seq 253 aa
MVLLPCEGGVWLSEGWRLASSNSRLTAVLSAHWLLSLPFGTGTFRPLALWGLLLVTVTAA
PTSQVLKDFRADTTSSKPTTSNSQAFRLFTLVLHDVQELKSETCKHNVNCLEEEKAMLNN
LNLPKIKIEDGCFYGGYNWETCHLKIITGLLKFQIYLQYMQNKLQSDSENEKAEKIYTSV
KSLSLFMKAKVSNTEQTVFPSPTANATLLEELESQNETQKLLIVQIVLCSLEEFLQNSLR
PIRKAGSDLDLDI
NT seq 762 nt   +upstreamnt  +downstreamnt
atggtgctcctcccttgtgagggaggtgtgtggctgagtgagggctggcgtctggccagc
tccaacagcaggctcacagctgtgctgtcagctcactggctgctctcccttcccttcggc
acaggcaccttccgtccacttgccttgtgggggctgctcctggtaacagttactgctgct
cccacctcacaagttctgaaagatttcagggctgatacgacgtcaagtaagccaacaacc
tctaattcacaagcgtttcgactgtttacgctagtcctccacgatgtccaggaactgaaa
agtgagacgtgcaaacataatgtcaattgcctagaggaggaaaaggcaatgttaaacaac
ctgaacctcccaaagataaaaatagaagatggatgcttctacggtggatacaactgggaa
acatgccacttgaaaatcatcactggtcttctgaagttccagatctacctgcagtacatg
cagaacaagcttcagagtgactctgaaaatgaaaaagctgaaaaaatatacactagtgtc
aaaagcttgagtctgttcatgaaagctaaggtaagcaatacagaacagacagtcttccct
agcccaactgcgaatgccaccctgctggaggagctggagtcacagaatgagactcagaag
cttttgatagttcaaatcgttctgtgcagccttgaagaattcctgcagaatagtctgagg
cctattcggaaagcaggttcagacttggacttagatatctaa

KEGG   Heterocephalus glaber (naked mole rat): 101703771
Entry
101703771         CDS       T02812                                 

Gene name
Ctf1
Definition
(RefSeq) cardiotrophin 1
  KO
K05422  cardiotrophin 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101703771 (Ctf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101703771 (Ctf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101703771 (Ctf1)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101703771 (Ctf1)
SSDB
Motif
Pfam: CNTF PRF Nup54 NolB
Other DBs
NCBI-GeneID: 101703771
NCBI-ProteinID: XP_004856250
LinkDB
Position
Un
AA seq 197 aa
MSLREGSLEDPQADSSVSFLPHLEAKIRQTHSLARLLTKYAEQLLQEYVQHQGAPFGSPG
FSPPRLPVAGLSAPAPGHAGLPLAERLRLDAEALAELPPLLDAVRHRQAELSPRALRLLR
RLEDATRQTRALGAALEAVLAALGAAAPGPRREPPAAPGPAGVFPAKLLGLRVCGLYREW
TRRTEGDLGQLLPGGPA
NT seq 594 nt   +upstreamnt  +downstreamnt
atgagcctgagggagggaagtctggaagacccccaggctgactcctcagtctcattcctt
ccccacttggaggccaagatccgccagacacacagccttgcccgcctcctcaccaaatat
gctgagcagctgctccaggaatatgtgcagcaccagggagcccccttcggctcgcccggc
ttctcgccgccgcggctgccggtggccggcctgagcgcgccggcgccgggccacgcgggg
ctgccgctggccgagcggctgcgcttggacgccgaggcgctggccgagctgcccccgctg
ttggatgccgtgcgccaccgccaggccgagctgagcccgcgcgcgctgcgcctgctgcgg
cgcctggaggacgcgacgcgccagacccgcgcgctgggtgccgccctggaggccgtgctg
gccgcgctgggcgccgccgccccggggccccgccgcgagcccccggccgcccccggcccc
gcgggcgtcttcccagccaagctgctggggctgcgcgtgtgcggcctctaccgcgagtgg
acgcgccgcaccgagggagacctgggccagctgctgcccgggggccccgcctga

KEGG   Heterocephalus glaber (naked mole rat): 101704388
Entry
101704388         CDS       T02812                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101704388
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101704388
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101704388
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101704388
SSDB
Motif
Pfam: PRF CNTF LIF_OSM IL11
Other DBs
NCBI-GeneID: 101704388
NCBI-ProteinID: XP_004856252
UniProt: G5BYK0
LinkDB
Position
Un
AA seq 220 aa
MNELAARAQPQGPGAELGFPLPAPLCLLSLLLPSPSLAAPISPAEPISQAYSLALYMQKN
TSTLLQTYLQYQGSPFSDPGFSAPELQLSSLPSAAVSFKTWHALEDRERLSRAQRAFLAL
TQHLQLVGDDQIDLNPGSPVLLAQLGVARLRAQGLLGNVAAIMNALGLPIPPEEDTLGLV
PFGASTFERKCRGYVVTREYGHWTDRAVRDLALLKAKYPV
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaatgaactggcagccagggctcagcctcaaggacccggtgctgagcttggatttcct
ctgccagcccccctctgcctgctgagcctgctgttgccatccccgagtctggcagccccc
atctcccccgctgagcccatcagtcaagcctatagcctggccctctacatgcagaagaac
acgtccacgctgctgcagacttacctccagtaccagggcagcccttttagtgaccctggc
ttctcagcccctgagctccagctcagcagcctgccttctgccgcagtctccttcaagacc
tggcatgccctggaagaccgggagcggctaagccgtgcccagagagccttcctggccttg
acccagcacctccagctcgtgggggatgaccagatcgacctgaatcctggtagtcctgtc
ctgctggcccagctcggagtggcgagactaagggcccaaggtctgcttggcaatgtggct
gccatcatgaacgccctggggctgcctattcccccagaagaggacactctaggtcttgtc
ccctttggggcctccacgttcgagagaaaatgtcgagggtatgtagtgacccgggaatat
gggcactggacagacagagctgtgagggatttggctctgctcaaggccaagtatccagtg
tga

KEGG   Heterocephalus glaber (naked mole rat): 101705496
Entry
101705496         CDS       T02812                                 

Gene name
Osm
Definition
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101705496 (Osm)
   04151 PI3K-Akt signaling pathway
    101705496 (Osm)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101705496 (Osm)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101705496 (Osm)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101705496 (Osm)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 101705496
NCBI-ProteinID: XP_004844122
LinkDB
Position
Un
AA seq 279 aa
MRAQLTWRTLLNPDRVTWGSSKGALRSARLGALPLGSSQQLVLPKGLRGLVLGLLLLSPA
VEAAVAMCRCSNSYTQLLGQLRSQANLMKDTSCLLEPFIRLQGLDTPVLRESCMKCSRAF
PSEDTLRGLSRHGFLQTVSATLNGILHRLAALQQHLLKGKNMPEMQVATRNIQGVRNNIY
CMSELLTNCSETPEPLLPGPRATLMPSTLNFFKSKLEGCQFLCGYHRFMGSVGQVFGEWG
NSLSRNRRHSPRQALHKGARRARPSRRVKRPVPRGQLFR
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcgggcacaactcacatggaggacgctgctcaatcccgaccgagtcacctggggaagt
agcaagggtgccttgcggtcggcacgcctgggcgccctgcccctcggctcttcccagcag
ctggtcctccccaaggggctgcgcggtctggtcctcggactcctgctcctgagcccagca
gtggaggcggcagtggccatgtgcagatgctccaactcttacacacagctcctcggccag
ctccggagccaggcgaacctcatgaaggacaccagctgcctcctggagccctttatccgc
ctccaaggcctggacacacctgtcctgagagagtcctgcatgaaatgttccagggccttc
cccagtgaggacaccctgcgggggctgagcaggcatggctttctgcagactgtcagtgcc
accctgaacggcatcctgcacagactggctgctttacagcagcatctcttgaagggcaag
aacatgccagagatgcaggtggccacgaggaacatccagggcgtcaggaacaacatctac
tgcatgtcagagctgctcaccaactgctcagagacgccagagcccctgctgcctggccca
cgggccacactgatgccctctaccctgaacttcttcaaatccaagctggagggctgccag
ttcctgtgtggctaccaccgcttcatgggctctgtggggcaggtctttggggagtggggg
aacagcctgagtcgtaaccggagacacagcccccgccaggccctgcataagggggcccgc
agggccaggccctccagaagggtcaagaggcctgtgcccagggggcagctgttccggtag

KEGG   Heterocephalus glaber (naked mole rat): 101706414
Entry
101706414         CDS       T02812                                 

Gene name
Il4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl05140  Leishmaniasis
hgl05200  Pathways in cancer
hgl05310  Asthma
hgl05320  Autoimmune thyroid disease
hgl05321  Inflammatory bowel disease
hgl05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101706414 (Il4)
   04151 PI3K-Akt signaling pathway
    101706414 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101706414 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101706414 (Il4)
   04660 T cell receptor signaling pathway
    101706414 (Il4)
   04658 Th1 and Th2 cell differentiation
    101706414 (Il4)
   04659 Th17 cell differentiation
    101706414 (Il4)
   04657 IL-17 signaling pathway
    101706414 (Il4)
   04664 Fc epsilon RI signaling pathway
    101706414 (Il4)
   04672 Intestinal immune network for IgA production
    101706414 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101706414 (Il4)
  09163 Immune disease
   05310 Asthma
    101706414 (Il4)
   05320 Autoimmune thyroid disease
    101706414 (Il4)
   05321 Inflammatory bowel disease
    101706414 (Il4)
   05330 Allograft rejection
    101706414 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101706414 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101706414 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101706414 (Il4)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101706414 (Il4)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101706414 (Il4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 101706414
NCBI-ProteinID: XP_012932792
UniProt: G5ASQ0
LinkDB
Position
Un
AA seq 140 aa
MGLVPQLTVTLFCLLACTGTFVRGCNDALQEIINDLNVLSSQKTPCAELAAADVFAAPKD
TAEKLCQAVTVLHRTSYLGVGLSCLNRHRESVFLVLLKKVYRNLRSMVQPNCSVSELKQT
TLKDFLENLKTILKKKYSEC
NT seq 423 nt   +upstreamnt  +downstreamnt
atgggtcttgtcccccagctgacagtcaccctgttctgcctcctagcatgtaccggcacc
ttcgtccgtggctgcaacgatgccttacaagaaatcatcaatgatctgaatgtgctctca
agccaaaagactccatgtgctgagctggctgctgcagacgtcttcgctgcccccaaggac
acagccgagaagctgtgccaggctgtgacagtgctgcatcgcacatcctacctcggggtg
gggctttcgtgcctgaacagacacagagaatcagtctttctggttctcctgaagaaggtc
tacaggaacctcaggagcatggttcagccgaactgttctgtgagtgaactcaagcagacg
acgttgaaagacttcttggaaaacctaaaaacgatcctgaaaaagaaatactcagagtgt
tga

KEGG   Heterocephalus glaber (naked mole rat): 101706424
Entry
101706424         CDS       T02812                                 

Gene name
Ifnk
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04622  RIG-I-like receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101706424 (Ifnk)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101706424 (Ifnk)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101706424 (Ifnk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101706424 (Ifnk)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101706424 (Ifnk)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 101706424
NCBI-ProteinID: XP_004838527
LinkDB
Position
Un
AA seq 171 aa
MIPKYLRLVYFVGLFIRHIQSQDCTLQNVRLSTVTKENVRLLSSVSNPLPLRCLREIKAF
GLPQNILSYSQHVERDIKEVFYDIIIQAFNIFSRHTSDSTWKEEYLTQIKRVQVVQQSKL
ALRGYFQRIENYLKDKKYSYCAWKIVQVEIKRCFFYFLKFIKLPRGNKVYF
NT seq 516 nt   +upstreamnt  +downstreamnt
atgattccaaaatacttaaggcttgtgtactttgtgggtctgttcattagacacatccaa
tctcaggactgtaccttacagaatgttcgcttgagtacagtcaccaaggagaatgtgaga
cttctgagcagtgtgagcaatccacttcctctgagatgtctaagagagatcaaagctttt
ggattgccccaaaatatcctctcatactctcagcatgtggaaagggacatcaaggaagtc
ttctatgatattatcatacaggccttcaacatcttcagccgacacacctccgactccact
tggaaagaggaatacctgacacaaatcaaaagagttcaggtcgtccagcagagcaaacta
gcattgagaggatatttccaaagaatagaaaattacctaaaggataagaaatacagttac
tgtgcctggaagattgtgcaagtggaaatcaaaagatgtttcttctactttctgaaattc
ataaagctacccagaggaaataaggtatacttttag

KEGG   Heterocephalus glaber (naked mole rat): 101706608
Entry
101706608         CDS       T02812                                 

Gene name
Il11
Definition
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101706608 (Il11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101706608 (Il11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101706608 (Il11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101706608 (Il11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101706608 (Il11)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101706608 (Il11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 101706608
NCBI-ProteinID: XP_012921617
LinkDB
Position
Un
AA seq 120 aa
MSASALGALQLPSVLTRLRTDLLSYLRHVQWLRRVGGPSLRTLEPELGTLQARLDRLLRR
LQLLMSVLALPQVPPEPPTPPLAPPASAWGGIRAAHAVLGGLHLTLDWAVRGLLLLKTRL
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagtgcgagtgcactgggagccctgcagctgcccagcgtgctcacgaggttgcggact
gacctgctgtcctacctgcgacacgtgcagtggctgcgccgggtgggtggcccttcgctg
aggaccctggagcctgagctgggcaccctgcaggcccggctggaccggctcctgcgcagg
ctgcagctcctgatgtccgtcctggccctgccccaggtgcccccagaaccgcccacacca
cccctggcacctcctgcctcagcctggggaggcatccgggcggcccacgccgtcctgggt
gggctgcacctcaccctggactgggccgtgcgggggctgctgctgctgaagacccggctg
tga

KEGG   Heterocephalus glaber (naked mole rat): 101707178
Entry
101707178         CDS       T02812                                 

Gene name
Il24
Definition
(RefSeq) interleukin 24
  KO
K22668  interleukin 24
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101707178 (Il24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101707178 (Il24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101707178 (Il24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101707178 (Il24)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101707178 (Il24)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 101707178
NCBI-ProteinID: XP_004862336
LinkDB
Position
Un
AA seq 329 aa
MLPTFNCDKFVTLLVHREFTVGALIHLAAKCPYTVCADSTAEYTPSFSSFLARGAERSCA
FFTAIRAEPPPPGSSAVPTAATVIAGRQVPEPRRRRHRGALRGAEGSDLSGPASLGHAAG
ERGSGAELRPRLKDQLPADSRTAGPEMGPWLQTAAFPLLGLILLLWSQVPGLQGHEFRFG
PCRVEGVALPSLWEAFRSLKDTVQAQDNITSIRLLRREVLQNVSDTESCHLIHDLLKFYL
NTVFKNYHHKIAESNMLPSFSTLANNFVFIVSKLQPSQKNEMLSVSDRARRRFLMFKRAF
KQLEIEAALTKAFGEVDILLTWMGRFYQF
NT seq 990 nt   +upstreamnt  +downstreamnt
atgctgcccacattcaactgtgacaagtttgtgacacttcttgtgcaccgagagtttaca
gttggtgcacttatacatctggcggccaagtgcccctacacggtctgtgcagacagtaca
gcagagtacactccgagtttctccagtttcttggcccgcggtgcggagcgcagctgcgcc
ttcttcacggcgatccgggccgagccgccgcctcccgggtcctcggcagtgcccaccgcc
gccactgtgatcgctggacggcaggtgcccgagccccggcggcggcggcacaggggggcc
ctgcggggagcggagggcagcgacctgagcggccccgccagcctcggacatgcggccggg
gagcgaggctcgggcgccgagttgaggccccgcctgaaggaccagctccctgcagacagc
cggacagccggacctgagatgggcccttggctccagacggctgccttccctcttctcggt
ctgatcctgcttctctggagccaggtgcccgggctccagggccacgagttccggtttggg
ccatgccgagtggagggagtggctctccccagcctgtgggaggccttccggagcctgaag
gacactgtgcaagctcaggacaacatcacgagcatccggctgctgcggcgagaggtcctg
cagaacgtctcggacactgagagctgccacctcatccacgacctgctgaagttctacctg
aacactgtgtttaaaaactaccaccacaaaatcgctgagtccaacatgctgccctccttc
tctaccctggccaacaactttgttttcattgtgtcaaaacttcaacccagtcagaagaat
gagatgctctctgtcagtgacagagcgcgtaggcggttcctgatgttcaagagagcgttc
aaacagttggagattgaagcagctctgaccaaagcctttggggaagtggacattctccta
acctggatgggcagattctaccagttctga

KEGG   Heterocephalus glaber (naked mole rat): 101707249
Entry
101707249         CDS       T02812                                 

Gene name
Il17d
Definition
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04657  IL-17 signaling pathway
hgl04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101707249 (Il17d)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101707249 (Il17d)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101707249 (Il17d)
   04659 Th17 cell differentiation
    101707249 (Il17d)
   04657 IL-17 signaling pathway
    101707249 (Il17d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101707249 (Il17d)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101707249 (Il17d)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 101707249
NCBI-ProteinID: XP_004854928
LinkDB
Position
Un
AA seq 216 aa
MLGGLRSAARPVPQVWMLVAGLLLALTPGRAAVRAGRRPARQRGCADRPEELLEQLYGRL
AAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPANLRSVSPWAYRISYDPARFP
RYLPEAYCLCRGCLTGPFGDEDFRFRSTPVYMPAVVLRRTSACAGGRSVYTEAYITVPVG
CTCVPQLEKDTASINSSIDKQGAKLLLGPSDEPGSP
NT seq 651 nt   +upstreamnt  +downstreamnt
atgctcgggggcttacgttctgcggcgcggcctgtcccgcaggtctggatgctcgtggca
ggccttctgctggcgctaacgccgggccgcgccgcggttagggcgggcaggcgcccggcg
cggcagcggggctgcgcggaccgacccgaggagctcctggagcagctgtacgggaggctg
gcggccggcgtgctcagcgccttccaccacaccttgcagctgggcccccgcgagcaggcg
cgcaatgcgagctgcccggcagggggcaggcccgccgaccgccgcttccggccgcccgcc
aacctgcgcagcgtctcgccctgggcctacaggatttcgtatgacccagcgaggttccca
cggtaccttcccgaagcctactgcctgtgccggggctgcctgaccgggccctttggcgat
gaggacttccgcttccgcagtacccccgtgtacatgcccgctgtggtcctgcgccgcacc
tcggcctgcgccggcggccgttctgtctacactgaggcctacatcacggtgcccgtcggc
tgcacttgcgttcctcagctggagaaggacacggccagcatcaactccagcatcgacaag
cagggtgccaaactgctgcttggccccagtgatgagccaggcagcccctga

KEGG   Heterocephalus glaber (naked mole rat): 101707902
Entry
101707902         CDS       T02812                                 

Gene name
Il23a
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl05133  Pertussis
hgl05152  Tuberculosis
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
hgl05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101707902 (Il23a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101707902 (Il23a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101707902 (Il23a)
   04659 Th17 cell differentiation
    101707902 (Il23a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101707902 (Il23a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101707902 (Il23a)
   05321 Inflammatory bowel disease
    101707902 (Il23a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101707902 (Il23a)
   05152 Tuberculosis
    101707902 (Il23a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101707902 (Il23a)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101707902 (Il23a)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 101707902
NCBI-ProteinID: XP_004861356
UniProt: G5BB75
LinkDB
Position
Un
AA seq 189 aa
MLGSTAVMLLLLLPWIAQGRAVAGSNNAAWAQCQQLSQKLCTLAWSAHPLVGHVDPPREE
GDEETADDVPHIQCGDGCDPQGLKDNSQFCLQRIYQGLIFYQKLLGSDIFTGEPSLLPDG
PVGQLHASLLGLSQLLQPEDHQQETQTPSLSPSQPWQRLLLRIKILRSLQAFVAVAARVF
AHGATTLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctgggaagcacagctgtgatgctgctactgctgctcccctggattgctcagggccgg
gctgtggctgggagcaacaacgctgcctgggcccagtgccagcagctgtcacagaagctc
tgcacgctggcttggagtgcacatccattagtgggacatgtggacccaccaagagaagag
ggagatgaagagactgcagacgatgtcccccatatccagtgtggggatggctgtgatcca
caaggactcaaagacaacagtcagttctgtttgcagaggatctaccagggtctaattttt
taccagaaactgctgggctcagacattttcacaggggagccttcactactccctgatggc
cccgtaggccagcttcatgcctccctgctgggcctcagccaactcctgcagcctgaggat
caccaacaggagactcagactccgagcctcagccccagccagccatggcagcgcctcctt
cttcgtatcaagatcctacgcagcctccaggcctttgtggctgtagctgcccgagtcttt
gcccatggagccacaactctgagcccctaa

KEGG   Heterocephalus glaber (naked mole rat): 101707909
Entry
101707909         CDS       T02812                                 

Gene name
Il20
Definition
(RefSeq) interleukin 20
  KO
K22667  interleukin 20
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101707909 (Il20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101707909 (Il20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101707909 (Il20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101707909 (Il20)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101707909 (Il20)
SSDB
Motif
Pfam: IL10 DUF4874 DUF5807
Other DBs
NCBI-GeneID: 101707909
NCBI-ProteinID: XP_004862338
UniProt: A0A0P6IWS2
LinkDB
Position
Un
AA seq 176 aa
MKTSGLAFGLLSATFYLLWTPSSGLKILHLGSCVIVTNLQEIQSEFSEIRDSVQASDKNI
DFRILRNTGSLQDTEPSDRCCLLRHLLRLYLDRVFKNYQTSDYHTLRKLSSLANSFLTMK
KDLQLCHAYMTCHCGEEATEKYRQILSHFEQLEPQAAAVKVLGELDILLRWMDEAE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaaacctctggtcttgccttcggccttctctctgccacattttatctcctctggact
ccttcatctgggctcaagattctccatttgggaagctgtgtgattgtcacaaacctccag
gaaatacaaagtgaattttctgagatccgggacagtgtgcaagccagtgacaaaaacatt
gacttcagaatcttaaggaacaccggatctttgcaagacacagagccttcagaccggtgt
tgcctcctccgccacttactgagactctacctggacagagtattcaaaaactaccagacc
tctgattaccacacactccggaagctcagcagtctggcgaattcctttcttactatgaaa
aaggacctccagctctgtcatgcctacatgacgtgccattgcggggaggaagcaacggag
aaatacaggcagattctgagtcactttgaacagctggagcctcaggcagcagcagtgaag
gttttgggggaactagacattcttctgcgatggatggatgaggcagaatag

KEGG   Heterocephalus glaber (naked mole rat): 101708273
Entry
101708273         CDS       T02812                                 

Gene name
Il10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04068  FoxO signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04660  T cell receptor signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl05133  Pertussis
hgl05135  Yersinia infection
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05143  African trypanosomiasis
hgl05144  Malaria
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05150  Staphylococcus aureus infection
hgl05152  Tuberculosis
hgl05310  Asthma
hgl05320  Autoimmune thyroid disease
hgl05321  Inflammatory bowel disease
hgl05322  Systemic lupus erythematosus
hgl05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101708273 (Il10)
   04068 FoxO signaling pathway
    101708273 (Il10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101708273 (Il10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101708273 (Il10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101708273 (Il10)
   04660 T cell receptor signaling pathway
    101708273 (Il10)
   04672 Intestinal immune network for IgA production
    101708273 (Il10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101708273 (Il10)
   05322 Systemic lupus erythematosus
    101708273 (Il10)
   05320 Autoimmune thyroid disease
    101708273 (Il10)
   05321 Inflammatory bowel disease
    101708273 (Il10)
   05330 Allograft rejection
    101708273 (Il10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101708273 (Il10)
   05133 Pertussis
    101708273 (Il10)
   05150 Staphylococcus aureus infection
    101708273 (Il10)
   05152 Tuberculosis
    101708273 (Il10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101708273 (Il10)
   05144 Malaria
    101708273 (Il10)
   05145 Toxoplasmosis
    101708273 (Il10)
   05140 Leishmaniasis
    101708273 (Il10)
   05142 Chagas disease
    101708273 (Il10)
   05143 African trypanosomiasis
    101708273 (Il10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101708273 (Il10)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101708273 (Il10)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101708273 (Il10)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101708273 (Il10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 101708273
NCBI-ProteinID: XP_004862339
UniProt: G5BP21
LinkDB
Position
Un
AA seq 178 aa
MPSSALLCCLVLLAGVRASQGMDTQSKDSCTRFPAGLPHMLQELRAAFGRVKTFFQTKDP
LDNTLLSQSLLEDFKGYLGCQALSEMIQFYLVEVMPKAENHDPDIKQHVNSLGEKLKTLR
LQLRRCHRFLPCENKSRAVEQVKDAFSKLQEKGVYKAMSEFDIFINYIEAYMTEKAAD
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagctcagcactgctgtgttgcctggtcttactggctggggtcagggccagccaa
ggcatggacacccagtctaaggactcctgcacccgcttcccagccggcctgccccacatg
ctccaagagctccgagctgcctttggcagagtgaagactttctttcaaacaaaggatcca
ctggacaacacgctgctgagccagtctttgctggaggactttaagggttacctgggctgc
caagccttgtcggagatgatccagttctacctggtggaggtgatgcccaaggcggagaat
cacgacccagacatcaagcagcacgtgaactccctgggggaaaagctcaagactctcagg
ctgcagctgcggcgctgtcaccggttccttccctgtgaaaataaaagcagagcggtggag
caggtgaaggacgccttcagcaagctccaggagaaaggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatcgaagcctacatgacagagaaggcagcagactaa

KEGG   Heterocephalus glaber (naked mole rat): 101713016
Entry
101713016         CDS       T02812                                 

Gene name
Il9
Definition
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl05310  Asthma
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101713016 (Il9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101713016 (Il9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101713016 (Il9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101713016 (Il9)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101713016 (Il9)
SSDB
Other DBs
NCBI-GeneID: 101713016
NCBI-ProteinID: XP_004836821
LinkDB
Position
Un
AA seq 144 aa
MPLVTVLTSALIFCSVAGQRCSTSSGIRYINYLISNLQKDPLSTCSCSANVTSCLCLPIP
SDNCTMPCFQEGLSQMTNITQKTKFSLTFNQVKRTVEVLKNNKCPSFSCEQPCNQTTAGN
TVTFLRNLLELFQRETMKGMRARA
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcctctggtcacagtcctcacctctgccttgatcttctgctccgttgcaggccagagg
tgctccacttcctcaggaatcaggtacatcaactacctcatcagcaatctgcagaaagat
ccgctgtccacatgcagctgcagtgccaacgtgaccagttgcttgtgcttgcctatccct
tctgacaactgcactatgccatgtttccaggaggggctgtcacagatgaccaacatcaca
cagaaaacaaaattctcgttgactttcaatcaggtgaaaagaacagttgaagtcctaaag
aacaacaagtgtccatctttttcttgtgaacagccttgcaaccaaaccacagcaggcaac
acggtgacatttctgaggaatctcctggaacttttccagagagaaacgatgaaagggatg
agagctcgagcatga

KEGG   Heterocephalus glaber (naked mole rat): 101713065
Entry
101713065         CDS       T02812                                 

Gene name
Lif
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04630  JAK-STAT signaling pathway
hgl04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101713065 (Lif)
   04668 TNF signaling pathway
    101713065 (Lif)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101713065 (Lif)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101713065 (Lif)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101713065 (Lif)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101713065 (Lif)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 101713065
NCBI-ProteinID: XP_004843487
UniProt: G5APV6
LinkDB
Position
Un
AA seq 200 aa
MKVLAAGVMPLLLVLHWKYGAGSPLPSVNATCATRHQCHSSVMSQIRNQLAQLNSSANAL
FILYYTAQGDPFPSNLDKLCAPNVTDFPAFHANGTEKAKLVELYRIIAYLGASLGNITQD
QKLLNPNALSLHSKLSATADVMRGVLSNVHCRLCNKYHVAHVDVAYGPDTSGKDVFQKKK
LGCQLLGKYKQVIGVVTQSF
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcagcaggagtcatgcccctgctgctggttctgcactggaaatatggt
gcaggaagccctcttccctctgtcaacgccacctgtgccacgcgtcaccaatgtcacagc
agcgtcatgagccagatcaggaaccaactggcacagctcaatagcagcgccaatgccctc
tttattctctattacacagcccagggggatccattccccagcaacctggacaagttgtgc
gctcccaatgtgacggacttcccggctttccatgccaatggcacggagaaggccaagctg
gtggagctgtatcgcatcatcgcctaccttggtgcttccttgggcaacatcactcaggac
cagaagctcctgaaccccaatgcactcagccttcatagcaagctcagtgccactgcagat
gttatgcggggggtcctcagcaatgtacactgccgtctgtgcaacaagtaccacgtggca
catgtggacgtggcctatggccccgacacttcaggcaaggatgtcttccagaagaagaag
ctgggatgtcaactgctggggaagtacaagcaagtcattggcgtagtgactcagtccttt
tag

KEGG   Heterocephalus glaber (naked mole rat): 101713773
Entry
101713773         CDS       T02812                                 

Gene name
Il7
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101713773 (Il7)
   04151 PI3K-Akt signaling pathway
    101713773 (Il7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101713773 (Il7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101713773 (Il7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101713773 (Il7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101713773 (Il7)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101713773 (Il7)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101713773 (Il7)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101713773 (Il7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 101713773
NCBI-ProteinID: XP_012926714
LinkDB
Position
Un
AA seq 251 aa
MTMPASRRPCSMVSAPLPGARVRAPGAPGDSGTRCRPPPPAPVLSLGRELPGPEDRGSQP
LVPGRLTLAGCGETTWCPLSVPRHSAATLALLGLGSPRSGHTVSFRYIFGIPPLILVLLP
VTSSNCHLKDKEGKGYENVIMISINELEKMLDIDNDCLKKEPNFFRRHSCADKKEAAFLN
RAAYKLEQFVKMNITTDFELHLLKVSQGTLKLINCTKEETISKETKKNDWCFLKALIQKI
KTCWNKILRGH
NT seq 756 nt   +upstreamnt  +downstreamnt
atgactatgcccgcctcccgcagaccatgttccatggtaagcgctcctctcccaggcgca
cgagttcgcgcgcctggcgcacccggggactctgggacgcgctgccgccctcccccgccc
gcccccgtcctctcccttggtcgggaactacccgggcccgaggaccgcggctcccagcct
cttgtacctgggcggctgactttggcaggctgcggagaaactacctggtgcccgctttct
gtcccgagacacagcgctgcaaccttggcgctgcttggccttggcagcccgcggtcaggt
catacagtttcttttaggtatatctttggaattcctcccttgatccttgttctgttacca
gtaacttcatctaattgtcatcttaaagataaagaaggtaaaggatatgagaatgttata
atgatcagcatcaatgaattggagaaaatgctagacattgataatgattgcctgaaaaaa
gaacctaacttttttaggagacattcatgtgcggataaaaaggaggctgcttttctaaat
cgtgctgcttacaagttggagcaatttgttaaaatgaatatcactacggattttgagcta
cacttattaaaagtttcacagggtacattaaaactgataaactgcaccaaggaagaaact
atttcaaaggaaacaaaaaagaatgactggtgtttcctgaaagcactaatacaaaagatt
aaaacttgttggaataaaatcttgagagggcattaa

KEGG   Heterocephalus glaber (naked mole rat): 101718152
Entry
101718152         CDS       T02812                                 

Gene name
Il13
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04664  Fc epsilon RI signaling pathway
hgl05200  Pathways in cancer
hgl05310  Asthma
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101718152 (Il13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101718152 (Il13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101718152 (Il13)
   04657 IL-17 signaling pathway
    101718152 (Il13)
   04664 Fc epsilon RI signaling pathway
    101718152 (Il13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718152 (Il13)
  09163 Immune disease
   05310 Asthma
    101718152 (Il13)
   05321 Inflammatory bowel disease
    101718152 (Il13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101718152 (Il13)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101718152 (Il13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 101718152
NCBI-ProteinID: XP_004836668
LinkDB
Position
Un
AA seq 131 aa
MALWVTVVLALTCLSALTAPGPVPSSAALRELIEELANVTQNHKTPLCSGSMVWSVNLTA
GWYCAARESLINVSSCSALQRTQKILSSLCQHRAVAKVSSFHNRDTKIEVAQFVQTLLRY
LQSLYRHGNFN
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgctctgggtgactgtggtcctcgctctcacctgcctcagtgccctcacagccccg
ggccccgtgccttcctccgcagccctcagggagctcatcgaggagctggccaacgtcacg
cagaaccacaagactcccctctgcagcggcagcatggtgtggagtgtcaacctgacagct
ggctggtactgtgctgcccgcgagtccctgatcaacgtctccagctgcagcgccctgcag
aggacccagaagatcctgagcagtctctgccagcacagggccgtggccaaggtttccagc
ttccacaaccgagacaccaaaattgaagtggcccaattcgtgcagacactgctccgatat
ttacagagcctttatcgccacggaaacttcaactga

KEGG   Heterocephalus glaber (naked mole rat): 101718208
Entry
101718208         CDS       T02812                                 

Gene name
Il15
Definition
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04668  TNF signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101718208 (Il15)
   04668 TNF signaling pathway
    101718208 (Il15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101718208 (Il15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101718208 (Il15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718208 (Il15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101718208 (Il15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101718208 (Il15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101718208 (Il15)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101718208 (Il15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 101718208
NCBI-ProteinID: XP_004868951
UniProt: A0A0P6K227
LinkDB
Position
Un
AA seq 162 aa
MRISKPYLRSTSIQCYLCFLLNSHFLTEAGIHVFVLGCISAALPKTEASWHDVIHDLKRI
ENLIQSIHIDATLYTESDVHPNCKITAMKCFLLELRVILHESRNVDIRETVTNVIFLANS
SLSTNGNVTESGCKECEELEEKNIAEFLQSFVHIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccatatttgaggagtacttccatccagtgctacttgtgttttctt
ctaaacagtcattttttaactgaggctggcattcacgtctttgttttgggttgtatcagt
gcagctcttcctaaaacagaagccagttggcatgatgtaatacatgacttgaaaagaatt
gaaaatcttattcaatctatacatattgatgctactttatatactgagagtgatgtccat
cccaattgcaaaatcacagcaatgaagtgctttctcctggaattgcgagttattttacat
gagtccagaaatgtggacattcgtgagacagtaaccaatgtgatcttcctggcaaatagc
agtttatctactaatgggaatgtaacagaatctggatgcaaagaatgtgaggaactggag
gaaaaaaatattgcagaatttctgcagagttttgtacatatagtacaaatgttcatcaac
acttcttga

KEGG   Heterocephalus glaber (naked mole rat): 101719419
Entry
101719419         CDS       T02812                                 

Definition
(RefSeq) interferon lambda-2
  KO
K22669  interferon lambda 2/3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101719419
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101719419
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101719419
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101719419
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 101719419
NCBI-ProteinID: XP_004875650
LinkDB
Position
Un
AA seq 167 aa
MKPDPAGGCVLLLLLMAMVLTRTGAVPVSSALSVSSDARHCHVAQFKSLSPLELQAFKSA
KDAFEERLLLKDSRCSSRLFPRAWDLRRLQVWERVVALHAELALTLEVLGSVRDPALEDV
LEQPLRTLRHIHSQLRACVPAQPKAAHRPCSHRLSRWLQRLNQATKK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaagccagaccccgctggaggttgcgtgctgttgctgctgctgatggccatggtgctc
accaggacaggggcagttcctgtctccagtgccctcagtgtctcctcagatgcgaggcac
tgccacgtggcccagttcaagtctctgtccccactagagctacaggctttcaagtcagcc
aaggatgcctttgaagagcggctcctgctgaaggactccaggtgcagctcgcgcctcttc
cccagggcctgggacctgcggcggctgcaggtgtgggagcgcgtggtggccctgcatgct
gagctcgccctgacactggaggtgctgggctccgtgagggacccagccctggaggacgtc
ctggagcagcccctccgcacgctgcgtcacatccactcccagctccgggcctgtgtccca
gctcagcccaaagcagcccacaggccctgcagccaccgcctgtcccgatggctgcagcgg
ctcaaccaggccaccaagaag

KEGG   Heterocephalus glaber (naked mole rat): 101719528
Entry
101719528         CDS       T02812                                 

Gene name
Il5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl05200  Pathways in cancer
hgl05310  Asthma
hgl05320  Autoimmune thyroid disease
hgl05321  Inflammatory bowel disease
hgl05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101719528 (Il5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101719528 (Il5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101719528 (Il5)
   04660 T cell receptor signaling pathway
    101719528 (Il5)
   04658 Th1 and Th2 cell differentiation
    101719528 (Il5)
   04657 IL-17 signaling pathway
    101719528 (Il5)
   04664 Fc epsilon RI signaling pathway
    101719528 (Il5)
   04672 Intestinal immune network for IgA production
    101719528 (Il5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101719528 (Il5)
  09163 Immune disease
   05310 Asthma
    101719528 (Il5)
   05320 Autoimmune thyroid disease
    101719528 (Il5)
   05321 Inflammatory bowel disease
    101719528 (Il5)
   05330 Allograft rejection
    101719528 (Il5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101719528 (Il5)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101719528 (Il5)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101719528 (Il5)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101719528 (Il5)
SSDB
Motif
Pfam: IL5 RecG_N AA_synth
Other DBs
NCBI-GeneID: 101719528
NCBI-ProteinID: XP_004836670
LinkDB
Position
Un
AA seq 134 aa
MRVLLLWGLLALGAVNVHPSPMGSSMRTVVKETLTLLSIHQTLLIGNETLRISVPAHKNH
QLCIEEIFQGINTLKNQTTQGDVLEELFQNLSLIKKHIDLQKQKCGEEQRRVKQFLDYLQ
EFLTVINTEWTMEG
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagagtgcttctgctttgggggctgctagctctgggagctgtgaatgttcatcccagc
cccatgggaagttccatgaggacagtggtgaaagagaccttgactctgctttctattcat
cagactctactgataggcaatgagaccctgaggatttctgttcctgcacataaaaatcac
caactatgcattgaagaaatcttccagggaataaacacattgaagaatcaaaccacacaa
ggggatgttttagaagaactattccaaaacttgtctttaattaaaaaacacatcgacctc
caaaaacaaaaatgtggggaagaacagcggagggtaaagcagttcttagattacctgcaa
gagtttcttactgtcataaatactgaatggacaatggaaggctga

KEGG   Heterocephalus glaber (naked mole rat): 101720581
Entry
101720581         CDS       T02812                                 

Gene name
Il2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04151  PI3K-Akt signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl04940  Type I diabetes mellitus
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05320  Autoimmune thyroid disease
hgl05321  Inflammatory bowel disease
hgl05330  Allograft rejection
hgl05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101720581 (Il2)
   04151 PI3K-Akt signaling pathway
    101720581 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101720581 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101720581 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101720581 (Il2)
   04660 T cell receptor signaling pathway
    101720581 (Il2)
   04658 Th1 and Th2 cell differentiation
    101720581 (Il2)
   04659 Th17 cell differentiation
    101720581 (Il2)
   04672 Intestinal immune network for IgA production
    101720581 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101720581 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101720581 (Il2)
   05321 Inflammatory bowel disease
    101720581 (Il2)
   05330 Allograft rejection
    101720581 (Il2)
   05332 Graft-versus-host disease
    101720581 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101720581 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101720581 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101720581 (Il2)
   05171 Coronavirus disease - COVID-19
    101720581 (Il2)
   05162 Measles
    101720581 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101720581 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101720581 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101720581 (Il2)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101720581 (Il2)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101720581 (Il2)
SSDB
Motif
Pfam: IL2 IL15
Other DBs
NCBI-GeneID: 101720581
NCBI-ProteinID: XP_004854993
LinkDB
Position
Un
AA seq 152 aa
MYKMLLLSCIALTLALITSSAPTSSSTRETQEQLEQLLLDLQVILKGVTRNPKLSKMLKP
KLYFPNKPSELQHLQCLEEELKVLEQVLNLAEHKHFPLINTKDFISNINVTVWKLKGSKT
ALTCELNDEEANIVQFLKGWIAFCQKIISTMT
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtacaagatgctgctcttgtcttgcattgcactaactcttgcactcatcacaagcagt
gcaccaacttcaagctctacaagggaaacacaggaacaactggagcaattgctgctggat
ttacaggtgattttgaaaggagttactaggaatcccaaactctccaagatgctaaaacct
aaactctactttcccaataaaccctcagaattgcaacatcttcagtgcctagaagaagaa
ctcaaagtcctggagcaagtgctaaatctagctgaacacaaacactttcccttgataaat
accaaggatttcatcagtaatatcaacgtaacagtttggaaactaaagggatccaaaaca
gcactcacgtgtgaactgaatgatgaagaagcaaacattgtacaatttctgaaaggatgg
attgccttttgtcagaaaatcatctcaacaatgacttaa

KEGG   Heterocephalus glaber (naked mole rat): 101720915
Entry
101720915         CDS       T02812                                 

Gene name
Il21
Definition
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101720915 (Il21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101720915 (Il21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101720915 (Il21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101720915 (Il21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101720915 (Il21)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101720915 (Il21)
SSDB
Motif
Pfam: IL15 Dynamin_M
Other DBs
NCBI-GeneID: 101720915
NCBI-ProteinID: XP_004854994
LinkDB
Position
Un
AA seq 153 aa
MRSSPGNMERIVICLMVIFSGTVALKSSSQGHDGFMIRMRQLIDIVDQLKNYVNDLDPVF
LPAPEDVKEHCEHSAFSCFQNATLKSASTGGNEKIINILIKQLKRKLPPSKTGRRQKHRQ
TCHSCDSYEKKPPQEFLERMKLFLQKMIHQHLS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggaaaggatagttatctgtctgatggtcatcttctcg
gggacagtggcccttaaatcaagttcccaaggacatgatggtttcatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggatcctgtattt
ttgccagctccagaagatgtaaaggaacactgtgagcactcagctttttcatgctttcag
aacgctacactcaagtcagcaagtacaggaggcaatgaaaagataatcaacatattaatt
aaacaattgaagaggaaactacctccctcaaagacagggagaagacagaaacacagacaa
acatgccattcatgtgattcttatgagaaaaaaccaccacaagaattcctagaaagaatg
aaattatttctccaaaagatgattcaccagcatctttcctag

KEGG   Heterocephalus glaber (naked mole rat): 101723869
Entry
101723869         CDS       T02812                                 

Definition
(RefSeq) interferon beta-like
  KO
K05415  interferon beta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04623  Cytosolic DNA-sensing pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04668  TNF signaling pathway
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101723869
   04668 TNF signaling pathway
    101723869
   04151 PI3K-Akt signaling pathway
    101723869
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101723869
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101723869
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101723869
   04621 NOD-like receptor signaling pathway
    101723869
   04622 RIG-I-like receptor signaling pathway
    101723869
   04623 Cytosolic DNA-sensing pathway
    101723869
   04650 Natural killer cell mediated cytotoxicity
    101723869
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101723869
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101723869
   05152 Tuberculosis
    101723869
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101723869
   05161 Hepatitis B
    101723869
   05160 Hepatitis C
    101723869
   05171 Coronavirus disease - COVID-19
    101723869
   05164 Influenza A
    101723869
   05162 Measles
    101723869
   05168 Herpes simplex virus 1 infection
    101723869
   05163 Human cytomegalovirus infection
    101723869
   05167 Kaposi sarcoma-associated herpesvirus infection
    101723869
   05169 Epstein-Barr virus infection
    101723869
   05165 Human papillomavirus infection
    101723869
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101723869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101723869
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interferons
   101723869
SSDB
Motif
Pfam: Interferon NYD-SP28 DUF2779 GAT
Other DBs
NCBI-GeneID: 101723869
NCBI-ProteinID: XP_004875658
UniProt: G5CB66
LinkDB
Position
Un
AA seq 187 aa
MANRCILQIALLLSFSTISLSLSYKLLQAQQRSSSLACGELLKQLKGKPEYCLKDRMDFK
FPEEIKQPQHFRKENAALVIQEMLQNILDIVRKNFSNTVWNETIVENLLVELHQQMDSLK
TLLQEILEKKDITWEDTMIIPRLKGYYWRIRRHMKAKDNSICAWTVVQVELSRNFSFINR
LTDYFQD
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccaacaggtgtatcctccaaattgctctcctgttgtccttctccaccatatctctt
tccttaagctacaaattgcttcaagcccaacaacgcagcagcagtttggcctgtggggag
cttttgaagcagttgaaaggaaaacctgaatattgcctcaaggacaggatggatttcaaa
ttccctgaggagatcaagcaaccacagcacttccggaaggagaatgctgctcttgtcatc
caggagatgctccagaatatcttggatattgtcagaaaaaatttctctaacactgtatgg
aatgagaccattgttgagaacctccttgttgaactccatcagcagatggacagtctgaag
acactcctgcaggaaatactggagaagaaggacattacctgggaggacaccatgatcatt
ccacgcctgaaggggtattattggaggatcaggaggcacatgaaggccaaggacaacagc
atttgtgcctggacagtagtccaggtagaactctccaggaacttttccttcattaacaga
cttacagattatttccaagactga

KEGG   Heterocephalus glaber (naked mole rat): 101724943
Entry
101724943         CDS       T02812                                 

Gene name
Csf2
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04650  Natural killer cell mediated cytotoxicity
hgl04657  IL-17 signaling pathway
hgl04660  T cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04668  TNF signaling pathway
hgl05146  Amoebiasis
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05171  Coronavirus disease - COVID-19
hgl05202  Transcriptional misregulation in cancer
hgl05221  Acute myeloid leukemia
hgl05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101724943 (Csf2)
   04668 TNF signaling pathway
    101724943 (Csf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101724943 (Csf2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101724943 (Csf2)
   04650 Natural killer cell mediated cytotoxicity
    101724943 (Csf2)
   04660 T cell receptor signaling pathway
    101724943 (Csf2)
   04657 IL-17 signaling pathway
    101724943 (Csf2)
   04664 Fc epsilon RI signaling pathway
    101724943 (Csf2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101724943 (Csf2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101724943 (Csf2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101724943 (Csf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101724943 (Csf2)
   05171 Coronavirus disease - COVID-19
    101724943 (Csf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101724943 (Csf2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101724943 (Csf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hgl03019]
    101724943 (Csf2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101724943 (Csf2)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101724943 (Csf2)
Messenger RNA biogenesis [BR:hgl03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     101724943 (Csf2)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101724943 (Csf2)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Cytokines
   101724943 (Csf2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 101724943
NCBI-ProteinID: XP_004836687
UniProt: G5BJ26
LinkDB
Position
Un
AA seq 144 aa
MWLQNLLLLGTVVCCICAPTLPPSPVTRPWKHVDAIKEALSLLNHTSDPDAVLNETVEVV
HDQFDPQEPTCLQIRLELLEKGLRGSLARLKGSLAMLASHYKQHCPPTPETSCMTQIVTF
KSFKKNLKDFLFAIPFDCWKPVQK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttctccttggcactgtggtttgttgcatctgtgcacccacc
ctcccgcccagccccgtcacccggccctggaaacacgtggatgccatcaaggaagccctg
agcctcctgaaccacactagtgaccctgatgctgtgctgaacgaaacagtagaagttgtc
catgaccagtttgacccccaggagccgacgtgcctgcagatccgcctggagctgttagag
aagggcctgcgcggcagcctggccaggctcaagggctccttggccatgctggccagccac
tacaagcagcactgcccccccaccccggaaacttcctgtatgacccagattgtcaccttc
aaaagtttcaaaaagaacctcaaggactttctgtttgccatcccttttgactgctggaag
ccagtgcagaagtga

KEGG   Heterocephalus glaber (naked mole rat): 101725985
Entry
101725985         CDS       T02812                                 

Gene name
Il19
Definition
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101725985 (Il19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101725985 (Il19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101725985 (Il19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101725985 (Il19)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101725985 (Il19)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 101725985
NCBI-ProteinID: XP_004862116
LinkDB
Position
Un
AA seq 176 aa
MKAQCASLWLLGTTLVLCSVHTPALRRCPLFVDMHHLEESFQEIKRAVQTKDTLQIITTL
STVEILRSIKPTDVCCVTKNLLEFYMDRVFKDHQELKPQILRKISSIANSFLYMQKTLRQ
CVHRRCHYSEEATHATRTVHDNYDLLEIPSAAIKSLGELDVFLAWIDRNRREADPV
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaggcacagtgtgcttctctctggctcctgggcaccacacttgtcctgtgctccgtg
cacacccctgccctcaggaggtgcccacttttcgtggacatgcatcacctagaggagagc
ttccaggaaatcaaaagagccgtgcaaaccaaggacaccctacaaatcatcaccaccctg
tccacagtggagatcctgcggagcattaagcccacggatgtgtgctgcgtgaccaagaac
cttctggagttctacatggacagggttttcaaggaccaccaggagctaaagcctcagatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaaccctacggcaa
tgcgtgcacagacggtgccactacagcgaggaagccacccatgcaaccagaactgtccat
gacaactacgatttgctggagatcccttccgccgccattaagtctctgggagagctcgat
gtctttctagcgtggattgacaggaatcgtcgggaagctgaccctgtctga

DBGET integrated database retrieval system