KEGG   Homo sapiens (human): 100507436
Entry
100507436         CDS       T01001                                 

Gene name
MICA, MIC-A, PERB11.1
Definition
(RefSeq) MHC class I polypeptide-related sequence A
  KO
K07985  MHC class I-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06129  MHC presentation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06229  MHC presentation
  Element
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Disease
H00288  Familial Mediterranean fever
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100507436 (MICA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100507436 (MICA)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 TDH C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 100507436
NCBI-ProteinID: NP_000238
OMIM: 600169
HGNC: 7090
Ensembl: ENSG00000204520
Vega: OTTHUMG00000031073
Pharos: Q29983(Tbio)
UniProt: Q29983
LinkDB
Structure
PDB: 
1HYR 1B3J

Position
6p21.33
AA seq 383 aa
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCD
RQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCE
IHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHY
HAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWR
QDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKV
LVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHR
DATQLGFQPLMSDLGSTGSTEGA
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggggctgggcccggtcttcctgcttctggctggcatcttcccttttgcacctccggga
gctgctgctgagccccacagtcttcgttataacctcacggtgctgtcctgggatggatct
gtgcagtcagggtttctcactgaggtacatctggatggtcagcccttcctgcgctgtgac
aggcagaaatgcagggcaaagccccagggacagtgggcagaagatgtcctgggaaataag
acatgggacagagagaccagagacttgacagggaacggaaaggacctcaggatgaccctg
gctcatatcaaggaccagaaagaaggcttgcattccctccaggagattagggtctgtgag
atccatgaagacaacagcaccaggagctcccagcatttctactacgatggggagctcttc
ctctcccaaaacctggagactaaggaatggacaatgccccagtcctccagagctcagacc
ttggccatgaacgtcaggaatttcttgaaggaagatgccatgaagaccaagacacactat
cacgctatgcatgcagactgcctgcaggaactacggcgatatctaaaatccggcgtagtc
ctgaggagaacagtgccccccatggtgaatgtcacccgcagcgaggcctcagagggcaac
attaccgtgacatgcagggcttctggcttctatccctggaatatcacactgagctggcgt
caggatggggtatctttgagccacgacacccagcagtggggggatgtcctgcctgatggg
aatggaacctaccagacctgggtggccaccaggatttgccaaggagaggagcagaggttc
acctgctacatggaacacagcgggaatcacagcactcaccctgtgccctctgggaaagtg
ctggtgcttcagagtcattggcagacattccatgtttctgctgttgctgctgctgctatt
tttgttattattattttctatgtccgttgttgtaagaagaaaacatcagctgcagagggt
ccagagctcgtgagcctgcaggtcctggatcaacacccagttgggacgagtgaccacagg
gatgccacacagctcggatttcagcctctgatgtcagatcttgggtccactggctccact
gagggcgcctag

KEGG   Homo sapiens (human): 4277
Entry
4277              CDS       T01001                                 

Gene name
MICB, PERB11.2
Definition
(RefSeq) MHC class I polypeptide-related sequence B
  KO
K07985  MHC class I-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06129  MHC presentation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06229  MHC presentation
  Element
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    4277 (MICB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    4277 (MICB)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 4277
NCBI-ProteinID: NP_005922
OMIM: 602436
HGNC: 7091
Ensembl: ENSG00000204516
Vega: OTTHUMG00000031074
Pharos: Q29980(Tbio)
UniProt: Q29980
LinkDB
Structure
PDB: 
2WY3 1JE6

Position
6p21.33
AA seq 383 aa
MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYD
RQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCE
IHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY
RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR
QDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKA
LVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHR
DAAQLGFQPLMSATGSTGSTEGT
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggggctgggccgggtcctgctgtttctggccgtcgccttcccttttgcacccccggca
gccgccgctgagccccacagtcttcgttacaacctcatggtgctgtcccaggatggatct
gtgcagtcagggtttctcgctgagggacatctggatggtcagcccttcctgcgctatgac
aggcagaaacgcagggcaaagccccagggacagtgggcagaaaatgtcctgggagctaag
acctgggacacagagaccgaggacttgacagagaatgggcaagacctcaggaggaccctg
actcatatcaaggaccagaaaggaggcttgcattccctccaggagattagggtctgtgag
atccatgaagacagcagcaccaggggctcccggcatttctactacgatggggagctcttc
ctctcccaaaacctggagactcaagaatcgacagtgccccagtcctccagagctcagacc
ttggctatgaacgtcacaaatttctggaaggaagatgccatgaagaccaagacacactat
cgcgctatgcaggcagactgcctgcagaaactacagcgatatctgaaatccggggtggcc
atcaggagaacagtgccccccatggtgaatgtcacctgcagcgaggtctcagagggcaac
atcaccgtgacatgcagggcttccagcttctatccccggaatatcacactgacctggcgt
caggatggggtatctttgagccacaacacccagcagtggggggatgtcctgcctgatggg
aatggaacctaccagacctgggtggccaccaggattcgccaaggagaggagcagaggttc
acctgctacatggaacacagcgggaatcacggcactcaccctgtgccctctgggaaggcg
ctggtgcttcagagtcaacggacagactttccatatgtttctgctgctatgccatgtttt
gttattattattattctctgtgtcccttgttgcaagaagaaaacatcagcggcagagggt
ccagagcttgtgagcctgcaggtcctggatcaacacccagttgggacaggagaccacagg
gatgcagcacagctgggatttcagcctctgatgtcagctactgggtccactggttccact
gagggcacctag

DBGET integrated database retrieval system