KEGG   Homo sapiens (human): 100533467
Entry
100533467         CDS       T01001                                 

Gene name
BIVM-ERCC5, ERCC5-202
Definition
(RefSeq) BIVM-ERCC5 readthrough
  KO
K10846  DNA excision repair protein ERCC-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100533467 (BIVM-ERCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    100533467 (BIVM-ERCC5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100533467 (BIVM-ERCC5)
SSDB
Motif
Pfam: XPG_I XPG_N 5_3_exonuc EF-G-binding_N
Other DBs
NCBI-GeneID: 100533467
NCBI-ProteinID: NP_001191354
HGNC: 43690
Ensembl: ENSG00000270181
Vega: OTTHUMG00000184166
UniProt: R4GMW8 Q59FZ7
LinkDB
Structure
PDB: 
5EKF

Position
13q33.1
AA seq 1640 aa
MPNVAETERSNDSGNGEHKSERKSPEENLQGAVKSFCTSASGAPLGPKGDGHYPWSCPVT
HTREKIYAICSDYAFLNQATSIYKTPNPSRSPCLPDSTSLSAGNNSSRYIGIPTSTSEII
YNEENSLENLSNSLGKLPLAWEIDKSEFDGVTTNSKHKSGNAKKQVSKRKTSDKKGRYQK
ECPQHSPLEDIKQRKVLDLRRWYCISRPQYKTSCGISSLISCWNFLYSTMGAGNLPPITQ
EEALHILGFQPPFEDIRFGPFTGNTTLMRWFRQINDHFHVKGCSYVLYKPHGKNKTAGET
ASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEATPVKANKAFSRGPLSPQEVEYWILI
GESSRKHPAIHCKKWADIVTDLNTQNPEYLDIRHLERGLQYRKTKKVGGNLHCIIAFQRL
NWQRFGLWNFPFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWK
KMSNISIWLNQALKGVRDRHGNSIENPHLLTLFHRLCKLLFFRIRPIFVFDGDAPLLKKQ
TLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIKTAFRSKRDEALPSLTQVRRENDLYVL
PPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFFHNPQAIDIESEDFSSLPPEVKHEILT
DMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQY
EDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPC
EKLKTEKEPDATPPSPRTLLAMQAALLGSSSEEELESENRRQARGRNAPAAVDEGSISPR
TLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMRINSSTENSDEGLKVRDGKGIPFTATL
ASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVHVGTEAFPISDESMIKDRKDRLPLESA
VVRHSDAPGLPNGRELTPASPTCTNSVSKNETHAEVLEQQNELCPYESKFDSSLLSSDDE
TKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNVENVVSFNAKEHENFLETIQEQQTTES
AGQDLISIPKAVEPMEIDSEESESDGSFIEVQSVISDEELQAEFPETSKPPSEQGEEELV
GTREGEAPAESESLLRDNSERDDVDGEPQEAEKDAEDSLHEWQDINLEELETLESNLLAQ
QNSLKAQKQQQERIAATVTGQMFLESQELLRLFGIPYIQAPMEAEAQCAILDLTDQTSGT
ITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDFHNQLGLDRNKLINLAYLLGSDYTEGI
PTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQKNPKIRPNPHDTKVKKKLRTLQLTPG
FPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDA
QQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFE
LLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAE
SSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTAR
SVFGKKRRKLRRARGRKRKT
NT seq 4923 nt   +upstreamnt  +downstreamnt
atgcctaacgttgcagaaacagaaaggtcaaatgattctggaaatggtgagcacaaatct
gagagaaagtcacctgaagagaatctacaaggtgctgtaaaatctttctgcacaagtgcc
tcaggagcacccttgggtcccaaaggagatggtcattatccatggagttgtccagtgact
catacacgggaaaaaatttatgccatctgttcggactatgcctttctcaaccaggcgacc
tcaatctataaaactccaaatccatcccgctctccttgcctccctgatagtacctcttta
tctgctggaaataattcatcaagatacattggtatcccgactagtacatcggaaattatc
tacaatgaagaaaatagcttggaaaacttatccaacagcctgggcaagctacctctcgca
tgggaaattgataaatctgaatttgatggggtgaccacaaattcgaaacacaaatcaggc
aatgcaaagaaacaagtttccaagagaaaaacttcagataaaaagggaagatatcagaag
gaatgtcctcagcattctcctcttgaagatattaaacagcggaaagtattagacctcaga
cgatggtactgcataagccgaccacagtataagacttcttgtggcatctcttcattaatt
tcttgttggaatttcttatacagcacaatgggagctggaaaccttccacctattacccaa
gaagaagctttacatattctgggctttcaacctccatttgaagatattaggtttggtcct
ttcacggggaatacaacacttatgaggtggtttagacaaattaatgaccacttccatgta
aaaggatgctcttatgttctatataagcctcatgggaagaataaaacagcaggagaaact
gcttcaggggccctgtcaaagttaacccgtggattgaaagatgaatcgctggcttatatc
tatcattgccaaaatcattatttttgtccaattggcttcgaagcaacccctgttaaagct
aataaagcattcagcaggggacctctctcaccacaggaagttgaatattggatcttaatt
ggagaatcaagtagaaaacatcctgccattcactgtaaaaaatgggcagatattgttact
gatctaaacactcaaaatccagaatacctggatatccggcacttagagaggggactgcag
tatagaaaaacaaagaaggttgggggaaatttgcattgcatcatagcattccagagactt
aactggcaaagatttggcctttggaactttccatttggaaccattagacaagaatcacaa
cctccaacacatgcccagggaattgccaaatctgagagtgaagacaatatttccaagaag
cagcatgggcgtctgggccggtctttcagtgctagtttccatcaggactcggcatggaaa
aagatgtctaatattagcatttggttaaaccaagcacttaaaggagtccgggatcgccat
gggaactcaatagaaaatcctcatcttctcactttgtttcatcggctctgcaaactctta
ttttttcgaattcgtcctatttttgtgtttgatggggatgctccactattgaagaaacag
actttggtgaagagaaggcagagaaaggacttagcgtccagtgactccaggaaaacgaca
gagaagcttctgaaaacatttttgaaaagacaagccatcaaaactgccttcagaagcaaa
agagatgaagcactacccagtcttacccaagttcgaagagaaaacgacctctatgttttg
cctcctttacaagaggaagaaaaacacagttcagaagaggaagatgaaaaagaatggcaa
gaaagaatgaatcaaaaacaagcattacaggaagagttctttcataatcctcaagcgata
gatattgagtctgaggacttcagcagcctgccccctgaagtaaagcatgaaatcttgact
gatatgaaagagttcaccaagcgcagaagaacattatttgaagcaatgccagaggagtct
gatgacttttcacagtaccaactcaaaggcttgcttaaaaagaactatctgaaccagcat
atagaacatgtccaaaaggaaatgaatcagcaacattcaggacacatccgaaggcagtat
gaagatgaagggggctttctgaaggaggtagagtcaaggagagtggtctctgaagacact
tcacattacatcttgataaaaggtattcaagctaagacagttgcagaagtggattcagag
tctcttccttcttccagcaaaatgcacggcatgtcttttgacgtgaagtcatctccatgt
gaaaaactgaagacagagaaagagcctgatgctacccctccttctccaagaactttacta
gctatgcaagctgccctgctgggaagtagctcagaagaggagctggagagtgaaaatcga
aggcaggcccgtgggaggaacgcacctgctgctgtagacgaaggctccatatcaccccgg
actctttcagccattaagagagctcttgacgatgacgaagatgtaaaagtgtgtgctggg
gatgatgtgcagacgggagggccaggagcagaagaaatgcgtataaacagctccaccgag
aacagtgatgaaggacttaaagtgagagatggaaaaggaataccgtttactgcaacactt
gcgtcatctagtgtgaactctgcagaggagcacgtagccagcactaatgaggggagagag
cccacagactcagttccaaaagaacaaatgtcacttgttcacgtggggactgaagccttt
ccgataagtgatgagtctatgattaaggacagaaaagatcggctgcctctggagagtgca
gtggttagacatagtgacgcacctgggctcccgaatggaagggaactgacaccggcatct
ccaacttgtacaaattctgtgtcaaagaatgaaacacatgctgaagtgcttgagcagcag
aacgaactttgcccatatgagagtaaattcgattcttctcttctttcaagtgatgatgaa
acaaaatgtaaaccgaattctgcttctgaagtcattggccctgtcagtttgcaagaaaca
agtagcatagtaagtgtcccttcagaggcagtagataatgtggaaaatgtggtgtcattt
aatgctaaagagcatgagaattttctggaaaccatccaagaacagcagaccactgaatct
gcaggccaggatttaatttccattccaaaggccgtggaaccaatggaaattgactcggaa
gaaagtgaatctgatggaagtttcattgaagtgcaaagtgtgattagtgatgaggaactt
caagcagaattccctgaaacttccaaacctccctcagaacaaggcgaagaggaactggta
ggaactagggagggagaagcccctgctgagtccgagagcctcctgagggacaactctgag
agggacgacgtggatggtgagccacaggaagctgagaaagatgcggaagattcgctccat
gaatggcaagatattaatttggaggagttggaaactctggagagcaacctcttagcacag
cagaattcactgaaagctcaaaaacagcagcaagaacggatcgctgctactgtcaccgga
cagatgttcctggaaagccaggaactcctgcgcctgttcggcattccctacatccaggct
cccatggaagcagaggcgcagtgcgccatcctggacctgactgatcagacttccggaacc
atcactgatgacagtgatatctggctgtttggagcgcggcatgtctatagaaactttttt
aataaaaacaagtttgtagaatattatcaatatgtggactttcacaatcaattgggattg
gaccggaataagttaataaatttggcttatttgcttggaagtgattataccgaaggaata
ccaactgtgggttgtgtaaccgccatggaaattctcaatgaattccctgggcatggcctg
gaacctctcctaaaattctcagaatggtggcatgaagctcaaaaaaatccaaagataaga
cctaatcctcatgacaccaaagtgaaaaaaaaattacggacattgcaactcacccctggc
tttcctaacccagctgttgccgaggcctacctcaaacccgtggtggatgactcgaaggga
tcctttctgtgggggaaacctgatctcgacaaaattagagaattttgtcagcggtatttc
ggctggaacagaacgaagacagatgaatctctgtttcctgtattaaagcaactcgatgcc
cagcagacacagctccgaattgattccttctttagattagcacaacaggagaaagaagat
gctaaacgtattaagagccagagactaaacagagctgtgacatgtatgctaaggaaagag
aaagaagcagcagccagcgaaatagaagcagtttctgttgccatggagaaagaatttgag
ctacttgataaggcaaaaggaaaaacccagaagagaggcataacaaataccttagaagag
tcatcaagcctgaaaagaaagaggctttcagattctaaaggaaagaatacatgcggtgga
tttttgggggagacctgcctctcagaatcatctgatggatcttcaagtgaagatgctgaa
agttcatctttaatgaatgtacaaaggagaacagctgcgaaagagccaaaaaccagtgct
tcagattcgcagaactcagtgaaggaagctcccgtgaagaatggaggtgcgaccaccagc
agctctagtgatagtgatgacgatggagggaaagagaagatggtcctcgtgaccgccaga
tctgtgtttgggaagaaaagaaggaaactaagacgtgcgaggggaagaaaaaggaaaacc
taa

KEGG   Homo sapiens (human): 2073
Entry
2073              CDS       T01001                                 

Gene name
ERCC5, COFS3, ERCC5-201, ERCM2, UVDR, XPG, XPGC
Definition
(RefSeq) ERCC excision repair 5, endonuclease
  KO
K10846  DNA excision repair protein ERCC-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    2073 (ERCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2073 (ERCC5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     2073 (ERCC5)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc EF-G-binding_N
Other DBs
NCBI-GeneID: 2073
NCBI-ProteinID: NP_000114
OMIM: 133530
HGNC: 3437
Ensembl: ENSG00000134899
Vega: OTTHUMG00000017310
Pharos: P28715(Tchem)
UniProt: P28715
LinkDB
Structure
PDB: 
5EKF

Position
13q33.1
AA seq 1186 aa
MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFH
RLCKLLFFRIRPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIK
TAFRSKRDEALPSLTQVRRENDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFF
HNPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKK
NYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTV
AEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQAALLGSSSEEE
LESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMR
INSSTENSDEGLKVRDGKGIPFTATLASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVH
VGTEAFPISDESMIKDRKDRLPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHA
EVLEQQNELCPYESKFDSSLLSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNV
ENVVSFNAKEHENFLETIQEQQTTESAGQDLISIPKAVEPMEIDSEESESDGSFIEVQSV
ISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESLLRDNSERDDVDGEPQEAEKD
AEDSLHEWQDINLEELETLESNLLAQQNSLKAQKQQQERIAATVTGQMFLESQELLRLFG
IPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDF
HNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQ
KNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIRE
FCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVT
CMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKG
KNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKN
GGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
NT seq 3561 nt   +upstreamnt  +downstreamnt
atgggggtccaggggctctggaagctgctggagtgctccgggcggcaggtcagccccgaa
gcgctggaagggaagatcctggctgttgatattagcatttggttaaaccaagcacttaaa
ggagtccgggatcgccatgggaactcaatagaaaatcctcatcttctcactttgtttcat
cggctctgcaaactcttattttttcgaattcgtcctatttttgtgtttgatggggatgct
ccactattgaagaaacagactttggtgaagagaaggcagagaaaggacttagcgtccagt
gactccaggaaaacgacagagaagcttctgaaaacatttttgaaaagacaagccatcaaa
actgccttcagaagcaaaagagatgaagcactacccagtcttacccaagttcgaagagaa
aacgacctctatgttttgcctcctttacaagaggaagaaaaacacagttcagaagaggaa
gatgaaaaagaatggcaagaaagaatgaatcaaaaacaagcattacaggaagagttcttt
cataatcctcaagcgatagatattgagtctgaggacttcagcagcctgccccctgaagta
aagcatgaaatcttgactgatatgaaagagttcaccaagcgcagaagaacattatttgaa
gcaatgccagaggagtctgatgacttttcacagtaccaactcaaaggcttgcttaaaaag
aactatctgaaccagcatatagaacatgtccaaaaggaaatgaatcagcaacattcagga
cacatccgaaggcagtatgaagatgaagggggctttctgaaggaggtagagtcaaggaga
gtggtctctgaagacacttcacattacatcttgataaaaggtattcaagctaagacagtt
gcagaagtggattcagagtctcttccttcttccagcaaaatgcacggcatgtcttttgac
gtgaagtcatctccatgtgaaaaactgaagacagagaaagagcctgatgctacccctcct
tctccaagaactttactagctatgcaagctgccctgctgggaagtagctcagaagaggag
ctggagagtgaaaatcgaaggcaggcccgtgggaggaacgcacctgctgctgtagacgaa
ggctccatatcaccccggactctttcagccattaagagagctcttgacgatgacgaagat
gtaaaagtgtgtgctggggatgatgtgcagacgggagggccaggagcagaagaaatgcgt
ataaacagctccaccgagaacagtgatgaaggacttaaagtgagagatggaaaaggaata
ccgtttactgcaacacttgcgtcatctagtgtgaactctgcagaggagcacgtagccagc
actaatgaggggagagagcccacagactcagttccaaaagaacaaatgtcacttgttcac
gtggggactgaagcctttccgataagtgatgagtctatgattaaggacagaaaagatcgg
ctgcctctggagagtgcagtggttagacatagtgacgcacctgggctcccgaatggaagg
gaactgacaccggcatctccaacttgtacaaattctgtgtcaaagaatgaaacacatgct
gaagtgcttgagcagcagaacgaactttgcccatatgagagtaaattcgattcttctctt
ctttcaagtgatgatgaaacaaaatgtaaaccgaattctgcttctgaagtcattggccct
gtcagtttgcaagaaacaagtagcatagtaagtgtcccttcagaggcagtagataatgtg
gaaaatgtggtgtcatttaatgctaaagagcatgagaattttctggaaaccatccaagaa
cagcagaccactgaatctgcaggccaggatttaatttccattccaaaggccgtggaacca
atggaaattgactcggaagaaagtgaatctgatggaagtttcattgaagtgcaaagtgtg
attagtgatgaggaacttcaagcagaattccctgaaacttccaaacctccctcagaacaa
ggcgaagaggaactggtaggaactagggagggagaagcccctgctgagtccgagagcctc
ctgagggacaactctgagagggacgacgtggatggtgagccacaggaagctgagaaagat
gcggaagattcgctccatgaatggcaagatattaatttggaggagttggaaactctggag
agcaacctcttagcacagcagaattcactgaaagctcaaaaacagcagcaagaacggatc
gctgctactgtcaccggacagatgttcctggaaagccaggaactcctgcgcctgttcggc
attccctacatccaggctcccatggaagcagaggcgcagtgcgccatcctggacctgact
gatcagacttccggaaccatcactgatgacagtgatatctggctgtttggagcgcggcat
gtctatagaaacttttttaataaaaacaagtttgtagaatattatcaatatgtggacttt
cacaatcaattgggattggaccggaataagttaataaatttggcttatttgcttggaagt
gattataccgaaggaataccaactgtgggttgtgtaaccgccatggaaattctcaatgaa
ttccctgggcatggcctggaacctctcctaaaattctcagaatggtggcatgaagctcaa
aaaaatccaaagataagacctaatcctcatgacaccaaagtgaaaaaaaaattacggaca
ttgcaactcacccctggctttcctaacccagctgttgccgaggcctacctcaaacccgtg
gtggatgactcgaagggatcctttctgtgggggaaacctgatctcgacaaaattagagaa
ttttgtcagcggtatttcggctggaacagaacgaagacagatgaatctctgtttcctgta
ttaaagcaactcgatgcccagcagacacagctccgaattgattccttctttagattagca
caacaggagaaagaagatgctaaacgtattaagagccagagactaaacagagctgtgaca
tgtatgctaaggaaagagaaagaagcagcagccagcgaaatagaagcagtttctgttgcc
atggagaaagaatttgagctacttgataaggcaaaaggaaaaacccagaagagaggcata
acaaataccttagaagagtcatcaagcctgaaaagaaagaggctttcagattctaaagga
aagaatacatgcggtggatttttgggggagacctgcctctcagaatcatctgatggatct
tcaagtgaagatgctgaaagttcatctttaatgaatgtacaaaggagaacagctgcgaaa
gagccaaaaaccagtgcttcagattcgcagaactcagtgaaggaagctcccgtgaagaat
ggaggtgcgaccaccagcagctctagtgatagtgatgacgatggagggaaagagaagatg
gtcctcgtgaccgccagatctgtgtttgggaagaaaagaaggaaactaagacgtgcgagg
ggaagaaaaaggaaaacctaa

DBGET integrated database retrieval system