KEGG   Homo sapiens (human): 10449
Entry
10449             CDS       T01001                                 

Gene name
ACAA2, DSAEC
Definition
(RefSeq) acetyl-CoA acyltransferase 2
  KO
K07508  acetyl-CoA acyltransferase 2 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00085  Fatty acid elongation in mitochondria
hsa_M00087  beta-Oxidation
Network
nt06020  beta-Oxidation in mitochondria
nt06024  Valine, leucine and isoleucine degradation
  Element
N00804  beta-Oxidation
N00856  Isoleucine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    10449 (ACAA2)
   00071 Fatty acid degradation
    10449 (ACAA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    10449 (ACAA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     10449 (ACAA2)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt IreB
Other DBs
NCBI-GeneID: 10449
NCBI-ProteinID: NP_006102
OMIM: 604770
HGNC: 83
Ensembl: ENSG00000167315
Vega: OTTHUMG00000132667
Pharos: P42765(Tbio)
UniProt: P42765 B3KNP8
LinkDB
Structure
PDB: 
4C2J 4C2K

Position
18q21.1
AA seq 397 aa
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL
QSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE
SMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECD
KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK
KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI
SGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSR
ITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggctctgctccgaggtgtgtttgtagttgctgctaagcgaacgccctttggagcttac
ggaggccttctgaaagacttcactgctactgacttgtctgaatttgctgccaaggctgcc
ttgtctgctggcaaagtctcacctgaaacagttgacagtgtgattatgggcaatgtcctg
cagagttcttcagatgctatatatttggcaaggcatgttggtttgcgtgtgggaatccca
aaggagaccccagctctcacgattaataggctctgtggttctggttttcagtccattgtg
aatggatgtcaggaaatttgtgttaaagaagctgaagttgttttatgtggaggaaccgaa
agcatgagccaagctccctactgtgtcagaaatgtgcgttttggaaccaagcttggatca
gatatcaagctggaagattctttatgggtatcattaacagatcagcatgtccagctcccc
atggcaatgactgcagagaatcttgctgtaaaacacaaaataagcagagaagaatgtgac
aaatatgccctgcagtcacagcagagatggaaagctgctaatgatgctggctactttaat
gatgaaatggcaccaattgaagtgaagacaaagaaaggaaaacagacaatgcaggtagac
gagcatgctcggccccaaaccaccctggaacagttacagaaacttcctccagtattcaag
aaagatggaactgttactgcagggaatgcatcgggtgtagctgatggtgctggagctgtt
atcatagctagtgaagatgctgttaagaaacataacttcacaccactggcaagaattgtg
ggctactttgtatctggatgtgatccctctatcatgggtattggtcctgtccctgctatc
agtggggcactgaagaaagcaggactgagtcttaaggacatggatttggtagaggtgaat
gaagcttttgctccccagtacttggctgttgagaggagtttggatcttgacataagtaaa
accaatgtgaatggaggagccattgctttgggtcacccactgggaggatctggatcaaga
attactgcacacctggttcacgaattaaggcgtcgaggtggaaaatatgccgttggatca
gcttgcattggaggtggccaaggtattgctgtcatcattcagagcacagcctga

KEGG   Homo sapiens (human): 30
Entry
30                CDS       T01001                                 

Gene name
ACAA1, ACAA, PTHIO, THIO
Definition
(RefSeq) acetyl-CoA acyltransferase 1
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00592  alpha-Linolenic acid metabolism
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
Module
hsa_M00087  beta-Oxidation
hsa_M00861  beta-Oxidation, peroxisome, VLCFA
Network
nt06021  beta-Oxidation in peroxisome
nt06024  Valine, leucine and isoleucine degradation
  Element
N00776  beta-Oxidation, peroxisome, VLCFA
N00856  Isoleucine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    30 (ACAA1)
   00592 alpha-Linolenic acid metabolism
    30 (ACAA1)
   01040 Biosynthesis of unsaturated fatty acids
    30 (ACAA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    30 (ACAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    30 (ACAA1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    30 (ACAA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     30 (ACAA1)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Other DBs
NCBI-GeneID: 30
NCBI-ProteinID: NP_001598
OMIM: 604054
HGNC: 82
Ensembl: ENSG00000060971
Vega: OTTHUMG00000131087
Pharos: P09110(Tbio)
UniProt: P09110 A0A024R2M6
LinkDB
Structure
PDB: 
2IIK

Position
3p22.2
AA seq 424 aa
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTT
PDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVN
RQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIP
MGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSI
TVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPI
LGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLR
LPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE
YPGN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcagaggctgcaggtagtgctgggccacctgaggggtccggccgattccggctggatg
ccgcaggccgcgccttgcctgagcggtgccccgcaggcctcggccgcggacgtggtggtg
gtgcacgggcggcgcacggccatctgccgggcgggccgcggcggcttcaaggacaccacc
cccgacgagcttctctcggcagtcatgaccgcggttctcaaggacgtgaatctgaggccg
gaacagctgggggacatctgtgtcggaaatgtgctgcagcctggggccggggcaatcatg
gcccgaatcgcccagtttctgagtgacatcccggagactgtgcctttgtccactgtcaat
agacagtgttcgtcggggctacaggcagtggccagcatagcaggtggcatcagaaatggg
tcttatgacattggcatggcctgtggggtggagtccatgtccctggctgacagagggaac
cctggaaatattacttcgcgcttgatggagaaggagaaggccagagattgcctgattcct
atggggataacctctgagaatgtggctgagcggtttggcatttcacgggagaagcaggat
acctttgccctggcttcccagcagaaggcagcaagagcccagagcaagggctgtttccaa
gctgagattgtgcctgtgaccaccacggtccatgatgacaagggcaccaagaggagcatc
actgtgacccaggatgagggtatccgccccagcaccaccatggagggcctggccaaactg
aagcctgccttcaagaaagatggttctaccacagctggaaactctagccaggtgagtgat
ggggcagctgccatcctgctggcccggaggtccaaggcagaagagttgggccttcccatc
cttggggtcctgaggtcttatgcagtggttggggtcccacctgacatcatgggcattgga
cctgcctatgccatcccagtagctttgcaaaaagcagggctgacagtgagtgacgtggac
atcttcgagatcaatgaggcctttgcaagccaggctgcctactgtgtggagaagctacga
ctcccccctgagaaggtgaaccccctggggggtgcagtggccttagggcacccactgggc
tgcactggggcacgacaggtcatcacgctgctcaatgagctgaagcgccgtgggaagagg
gcatacggagtggtgtccatgtgcatcgggactggaatgggagccgctgccgtctttgaa
taccctgggaactga

KEGG   Homo sapiens (human): 3032
Entry
3032              CDS       T01001                                 

Gene name
HADHB, ECHB, MSTP029, MTPB, TP-BETA
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
  KO
K07509  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00085  Fatty acid elongation in mitochondria
hsa_M00087  beta-Oxidation
Network
nt06020  beta-Oxidation in mitochondria
nt06024  Valine, leucine and isoleucine degradation
  Element
N00766  HADHB deficiency in beta-oxidation
N00804  beta-Oxidation
N00856  Isoleucine degradation
Disease
H00525  Disorders of mitochondrial fatty-acid oxidation
H01352  Mitochondrial trifunctional protein deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    3032 (HADHB)
   00071 Fatty acid degradation
    3032 (HADHB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3032 (HADHB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     3032 (HADHB)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-GeneID: 3032
NCBI-ProteinID: NP_000174
OMIM: 143450
HGNC: 4803
Ensembl: ENSG00000138029
Vega: OTTHUMG00000096978
Pharos: P55084(Tbio)
UniProt: P55084
LinkDB
Structure
PDB: 
6DV2 5ZQZ 5ZRV

Position
2p23.3
AA seq 474 aa
MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGV
RTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAA
LGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMR
KLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLE
QDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPY
GTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATP
KVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNW
GGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgactatcttgacttacccctttaaaaatcttcccactgcatcaaaatgggccctcaga
ttttccataagacctctgagctgttcctcccagctacgagctgccccagctgtccagacc
aaaacgaagaagacgttagccaaacccaatataaggaatgttgtggtggtggatggtgtt
cgcactccatttttgctgtctggcacttcatataaagacctgatgccacatgatttggct
agagcagcgcttacgggtttgttgcatcggaccagtgtccctaaggaagtagttgattat
atcatctttggtacagttattcaggaagtgaaaacaagcaatgtggctagagaggctgcc
cttggagctggcttctctgacaagactcctgctcacactgtcaccatggcttgtatctct
gccaaccaagccatgaccacaggtgttggcttgattgcttctggccagtgtgatgtgatc
gtggcaggtggtgttgagttgatgtccgatgtccctattcgtcactcaaggaaaatgaga
aaactgatgcttgatctcaataaggccaaatctatgggccagcgactgtctttaatctct
aaattccgatttaatttcctagcacctgagctccctgcggtttctgagttctccaccagt
gagaccatgggccactctgcagaccgactggccgctgcctttgctgtttctcggctggaa
caggatgaatatgcactgcgctctcacagtctagccaagaaggcacaggatgaaggactc
ctttctgatgtggtacccttcaaagtaccaggaaaagatacagttaccaaagataatggc
atccgtccttcctcactggagcagatggccaaactaaaacctgcattcatcaagccctac
ggcacagtgacagctgcaaattcttctttcttgactgatggtgcatctgcaatgttaatc
atggcggaggaaaaggctctggccatgggttataagccgaaggcatatttgagggatttt
atgtatgtgtctcaggatccaaaagatcaactattacttggaccaacatatgctactcca
aaagttctagaaaaggcaggattgaccatgaatgatattgatgcttttgaatttcatgaa
gctttctcgggtcagattttggcaaattttaaagccatggattctgattggtttgcagaa
aactacatgggtagaaaaaccaaggttggattgcctcctttggagaagtttaataactgg
ggtggatctctgtccctgggacacccatttggagccactggctgcaggttggtcatggct
gctgccaacagattacggaaagaaggaggccagtatggcttagtggctgcgtgtgcagct
ggagggcagggccatgctatgatagtggaagcttatccaaaataa

DBGET integrated database retrieval system