KEGG   Homo sapiens (human): 11023
Entry
11023             CDS       T01001                                 

Gene name
VAX1, MCOPS11
Definition
(RefSeq) ventral anterior homeobox 1
  KO
K09318  homeobox protein ventral anterior
Organism
hsa  Homo sapiens (human)
Disease
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    11023 (VAX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Ems
    11023 (VAX1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN HTH_28 Homez
Other DBs
NCBI-GeneID: 11023
NCBI-ProteinID: NP_001106175
OMIM: 604294
HGNC: 12660
Ensembl: ENSG00000148704
Vega: OTTHUMG00000019117
Pharos: Q5SQQ9(Tbio)
UniProt: Q5SQQ9
LinkDB
Position
10q25.3
AA seq 334 aa
MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDC
NKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQ
RCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLR
LLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAPGPAGAA
SPHPPAVGGAPGPGPAGPGGLHAGAPAAGHSLFSLPVPSLLGSVASRLSSAPLTMAGSLA
GNLQELSARYLSSSAFEPYSRTNNKEGAEKKALD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgttcgggaaaccagacaaaatggacgttcgatgccactcggacgccgaggctgcccgg
gtctcgaagaacgcgcacaaggagagtcgggagagcaagggcgcggaggggaacctccca
gccgccttcctcaaggagccgcagggcgccttctcagcgtcgggcgctgctgaggattgt
aacaaaagtaaatccaattccgcagcggacccggattactgccgccggatcctggtccga
gatgccaaggggtccatccgagagatcatcctgcccaagggcctggacttggaccggcct
aagaggacgcgcacgtccttcaccgcggagcagctctatcggctggagatggagttccag
cgctgccagtacgtggtgggccgcgagaggaccgagctcgcccggcagcttaacctctcc
gagacccaggtgaaggtctggttccagaaccggcgcaccaagcagaagaaggaccagggc
aaggactcggagctacgctcggtggtgtcggagaccgcggccacgtgcagcgtgctacgg
ctgctggagcagggccgcctgttgtcgccgcccggcctgcctgcgctgctgccgccttgc
gccacgggcgctctcggctcagcgctgcgcgggcccagcttgccggccctgggcgcgggc
gccgctgcaggctcggccgccgcagccgccgccgccgccccgggcccagcgggcgctgca
tccccgcacccgccggctgtgggcggtgctccaggtcccgggcccgccgggccgggggga
ttgcacgcaggcgccccggccgcgggccacagcctcttcagcctgccggtgccctcgctg
ctcggctccgtcgccagccgcctgtcctccgccccgttaacaatggctggttcgctagct
gggaatttgcaagaactctccgcccgatatctgagctcctcggccttcgagccttactcc
cggaccaacaataaagaaggggccgagaaaaaagcgctggactga

DBGET integrated database retrieval system