KEGG   Homo sapiens (human): 11197Help
Entry
11197             CDS       T01001                                 

Gene name
WIF1, WIF-1
Definition
(RefSeq) WNT inhibitory factor 1
  KO
K01691  WNT inhibitory factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    11197 (WIF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WIF EGF_2 hEGF EGF
Motif
Other DBs
NCBI-GeneID: 11197
NCBI-ProteinID: NP_009122
OMIM: 605186
HGNC: 18081
Ensembl: ENSG00000156076
Vega: OTTHUMG00000168832
Pharos: Q9Y5W5(Tbio)
UniProt: Q9Y5W5
LinkDB All DBs
Structure
PDB: 

Position
12q14.3
AA seq 379 aa AA seqDB search
MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQA
ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN
CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHT
PSLKKAEERRDPPESNYIW
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaggagcgccttccctgccgccgcgctctggctctggagcatcctcctgtgc
ctgctggcactgcgggcggaggccgggccgccgcaggaggagagcctgtacctatggatc
gatgctcaccaggcaagagtactcataggatttgaagaagatatcctgattgtttcagag
gggaaaatggcaccttttacacatgatttcagaaaagcacaacagagaatgccagctatt
cctgtcaatatccattccatgaattttacctggcaagctgcagggcaggcagaatacttc
tatgaattcctgtccttgcgctccctggataaaggcatcatggcagatccaaccgtcaat
gtccctctgctgggaacagtgcctcacaaggcatcagttgttcaagttggtttcccatgt
cttggaaaacaggatggggtggcagcatttgaagtggatgtgattgttatgaattctgaa
ggcaacaccattctccaaacacctcaaaatgctatcttctttaaaacatgtcaacaagct
gagtgcccaggcgggtgccgaaatggaggcttttgtaatgaaagacgcatctgcgagtgt
cctgatgggttccacggacctcactgtgagaaagccctttgtaccccacgatgtatgaat
ggtggactttgtgtgactcctggtttctgcatctgcccacctggattctatggagtgaac
tgtgacaaagcaaactgctcaaccacctgctttaatggagggacctgtttctaccctgga
aaatgtatttgccctccaggactagagggagagcagtgtgaaatcagcaaatgcccacaa
ccctgtcgaaatggaggtaaatgcattggtaaaagcaaatgtaagtgttccaaaggttac
cagggagacctctgttcaaagcctgtctgcgagcctggctgtggtgcacatggaacctgc
catgaacccaacaaatgccaatgtcaagaaggttggcatggaagacactgcaataaaagg
tacgaagccagcctcatacatgccctgaggccagcaggcgcccagctcaggcagcacacg
ccttcacttaaaaaggccgaggagcggcgggatccacctgaatccaattacatctggtga

DBGET integrated database retrieval system