KEGG   Homo sapiens (human): 1154Help
Entry
1154              CDS       T01001                                 

Gene name
CISH, BACTS2, CIS, CIS-1, G18, SOCS
Definition
(RefSeq) cytokine inducible SH2 containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1154 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    1154 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1154 (CISH)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     1154 (CISH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 1154
NCBI-ProteinID: NP_659508
OMIM: 602441
HGNC: 1984
Ensembl: ENSG00000114737
Vega: OTTHUMG00000156853
Pharos: Q9NSE2(Tbio)
UniProt: Q9NSE2
LinkDB All DBs
Position
3p21.2
AA seq 258 aa AA seqDB search
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctgcgttcagggacctcgtcctttgctggctgtggagcggactgggcagcgg
cccctgtgggccccgtccctggaactgcccaagccagtcatgcagcccttgcctgctggg
gccttcctcgaggaggtggcagagggtaccccagcccagacagagagtgagccaaaggtg
ctggacccagaggaggatctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggctggtattggggttccattacggccagcgaggcccgacaacacctgcagaagatgcca
gaaggcacgttcttagtacgtgacagcacgcaccccagctacctgttcacgctgtcagtg
aaaaccactcgtggccccaccaatgtacgcattgagtatgccgactccagcttccgtctg
gactccaactgcttgtccaggccacgcatcctggcctttccggatgtggtcagccttgtg
cagcactatgtggcctcctgcactgctgatacccgaagcgacagccccgatcctgctccc
accccggccctgcctatgcctaaggaggatgcgcctagtgacccagcactgcctgctcct
ccaccagccactgctgtacacctaaaactggtgcagccctttgtacgcagaagcagtgcc
cgcagcctgcaacacctgtgccgccttgtcatcaaccgtctggtggccgacgtggactgc
ctgccactgccccggcgcatggccgactacctccgacagtaccccttccagctctga

DBGET integrated database retrieval system