KEGG   Homo sapiens (human): 1241
Entry
1241              CDS       T01001                                 

Gene name
LTB4R, BLT1, BLTR, CMKRL1, GPR16, LTB4R1, LTBR1, P2RY7, P2Y7
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  leukotriene B4 receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Etalocib: D04074
Moxilubant maleate: D05085
Ticolubant: D06140
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1241 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1241 (LTB4R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Leukotriene
    1241 (LTB4R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 1241
NCBI-ProteinID: NP_001137391
OMIM: 601531
HGNC: 6713
Ensembl: ENSG00000213903
Vega: OTTHUMG00000029346
Pharos: Q15722(Tchem)
UniProt: Q15722
LinkDB
Position
14q12
AA seq 352 aa
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaacactacatcttctgcagcacccccctcactaggtgtagagttcatctctctgctg
gctatcatcctgctgtcagtggcgctggctgtggggcttcccggcaacagctttgtggtg
tggagtatcctgaaaaggatgcagaagcgctctgtcactgccctgatggtgctgaacctg
gccctggccgacctggccgtattgctcactgctccctttttccttcacttcctggcccaa
ggcacctggagttttggactggctggttgccgcctgtgtcactatgtctgcggagtcagc
atgtacgccagcgtcctgcttatcacggccatgagtctagaccgctcactggcggtggcc
cgcccctttgtgtcccagaagctacgcaccaaggcgatggcccggcgggtgctggcaggc
atctgggtgttgtcctttctgctggccacacccgtcctcgcgtaccgcacagtagtgccc
tggaaaacgaacatgagcctgtgcttcccgcggtaccccagcgaagggcaccgggccttc
catctaatcttcgaggctgtcacgggcttcctgctgcccttcctggctgtggtggccagc
tactcggacatagggcgtcggctacaggcccggcgcttccgccgcagccgccgcaccggc
cgcctggtggtgctcatcatcctgaccttcgccgccttctggctgccctaccacgtggtg
aacctggctgaggcgggccgcgcgctggccggccaggccgccgggttagggctcgtgggg
aagcggctgagcctggcccgcaacgtgctcatcgcactcgccttcctgagcagcagcgtg
aaccccgtgctgtacgcgtgcgccggcggcggcctgctgcgctcggcgggcgtgggcttc
gtcgccaagctgctggagggcacgggctccgaggcgtccagcacgcgccgcgggggcagc
ctgggccagaccgctaggagcggccccgccgctctggagcccggcccttccgagagcctc
actgcctccagccctctcaagttaaacgaactgaactag

KEGG   Homo sapiens (human): 56413
Entry
56413             CDS       T01001                                 

Gene name
LTB4R2, BLT2, BLTR2, JULF2, KPG_004, LTB4-R_2, LTB4-R2, NOP9
Definition
(RefSeq) leukotriene B4 receptor 2
  KO
K04297  leukotriene B4 receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Etalocib: D04074
Moxilubant maleate: D05085
Ticolubant: D06140
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    56413 (LTB4R2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56413 (LTB4R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    56413 (LTB4R2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Leukotriene
    56413 (LTB4R2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 56413
NCBI-ProteinID: NP_001158164
OMIM: 605773
HGNC: 19260
Ensembl: ENSG00000213906
Vega: OTTHUMG00000186500
Pharos: Q9NPC1(Tchem)
UniProt: Q9NPC1 B4E292
LinkDB
Position
14q12
AA seq 358 aa
MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtcggtctgctaccgtcccccagggaacgagacactgctgagctggaagacttcgcgg
gccacaggcacagccttcctgctgctggcggcgctgctggggctgcctggcaacggcttc
gtggtgtggagcttggcgggctggcggcctgcacgggggcgaccgctggcggccacgctt
gtgctgcacctggcgctggccgacggcgcggtgctgctgctcacgccgctctttgtggcc
ttcctgacccggcaggcctggccgctgggccaggcgggctgcaaggcggtgtactacgtg
tgcgcgctcagcatgtacgccagcgtgctgctcaccggcctgctcagcctgcagcgctgc
ctcgcagtcacccgccccttcctggcgcctcggctgcgcagcccggccctggcccgccgc
ctgctgctggcggtctggctggccgccctgttgctcgccgtcccggccgccgtctaccgc
cacctgtggagggaccgcgtatgccagctgtgccacccgtcgccggtccacgccgccgcc
cacctgagcctggagactctgaccgctttcgtgcttcctttcgggctgatgctcggctgc
tacagcgtgacgctggcacggctgcggggcgcccgctggggctccgggcggcacggggcg
cgggtgggccggctggtgagcgccatcgtgcttgccttcggcttgctctgggccccctac
cacgcagtcaaccttctgcaggcggtcgcagcgctggctccaccggaaggggccttggcg
aagctgggcggagccggccaggcggcgcgagcgggaactacggccttggccttcttcagt
tctagcgtcaacccggtgctctacgtcttcaccgctggagatctgctgccccgggcaggt
ccccgtttcctcacgcggctcttcgaaggctctggggaggcccgagggggcggccgctct
agggaagggaccatggagctccgaactacccctcagctgaaagtggtggggcagggccgc
ggcaatggagacccggggggtgggatggagaaggacggtccggaatgggacctttga

DBGET integrated database retrieval system