KEGG   Homo sapiens (human): 1258
Entry
1258              CDS       T01001                                 

Gene name
CNGB1, CNCG2, CNCG3L, CNCG4, CNG4, CNGB1B, GAR1, GARP, GARP2, RCNC2, RCNCb, RCNCbeta, RP45
Definition
(RefSeq) cyclic nucleotide gated channel subunit beta 1
  KO
K04952  cyclic nucleotide gated channel beta 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1258 (CNGB1)
   04022 cGMP-PKG signaling pathway
    1258 (CNGB1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    1258 (CNGB1)
   04740 Olfactory transduction
    1258 (CNGB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1258 (CNGB1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1258 (CNGB1)
SSDB
Motif
Pfam: cNMP_binding Npa1
Other DBs
NCBI-GeneID: 1258
NCBI-ProteinID: NP_001288
OMIM: 600724
HGNC: 2151
Ensembl: ENSG00000070729
Vega: OTTHUMG00000154810
Pharos: Q14028(Tbio)
UniProt: Q14028
LinkDB
Position
16q21
AA seq 1251 aa
MLGWVQRVLPQPPGTPRKTKMQEEEEVEPEPEMEAEVEPEPNPEEAETESESMPPEESFK
EEEVAVADPSPQETKEAALTSTISLRAQGAEISEMNSPSRRVLTWLMKGVEKVIPQPVHS
ITEDPAQILGHGSTGDTGCTDEPNEALEAQDTRPGLRLLLWLEQNLERVLPQPPKSSEVW
RDEPAVATGAASDPAPPGRPQEMGPKLQARETPSLPTPIPLQPKEEPKEAPAPEPQPGSQ
AQTSSLPPTRDPARLVAWVLHRLEMALPQPVLHGKIGEQEPDSPGICDVQTISILPGGQV
EPDLVLEEVEPPWEDAHQDVSTSPQGTEVVPAYEEENKAVEKMPRELSRIEEEKEDEEEE
EEEEEEEEEEEVTEVLLDSCVVSQVGVGQSEEDGTRPQSTSDQKLWEEVGEEAKKEAEEK
AKEEAEEVAEEEAEKEPQDWAETKEEPEAEAEAASSGVPATKQHPEVQVEDTDADSCPLM
AEENPPSTVLPPPSPAKSDTLIVPSSASGTHRKKLPSEDDEAEELKALSPAESPVVAWSD
PTTPKDTDGQDRAASTASTNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKP
SPAKKAPEPAPDTKPAEAEPVEEEHYCDMLCCKFKHRPWKKYQFPQSIDPLTNLMYVLWL
FFVVMAWNWNCWLIPVRWAFPYQTPDNIHHWLLMDYLCDLIYFLDITVFQTRLQFVRGGD
IITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRCLKYMAFFEFNSRLE
SILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYDGVGNSYIRCYYFAV
KTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDST
VKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKV
ALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLV
TLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKA
RRMLRSNNKPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGKLAHLRARLKELA
ALEAAAKQQELVEQAKSSQDVKGEEGSAAPDQHTHPKEAATDPPAPRTPPEPPGSPPSSP
PPASLGRPEGEEEGPAEPEEHSVRICMSPGPEPGEQILSVKMPEEREEKAE
NT seq 3756 nt   +upstreamnt  +downstreamnt
atgttgggctgggtccagagggtgctgcctcagcccccagggacccctcggaagaccaag
atgcaggaggaagaggaagtggaaccagagccagagatggaggcggaggtggaaccagaa
ccgaatcctgaggaggccgagacagagtccgagtccatgccccccgaagagtcattcaag
gaggaggaagtggctgtggcagacccaagccctcaggagaccaaggaggctgcccttact
tccaccatatccctccgggcccagggcgctgagatttctgaaatgaatagtcccagccgc
agggtactgacctggctcatgaagggcgtagagaaggtgatcccgcagcctgttcacagc
atcacggaggacccggctcagatcctggggcatggcagcactggggacacagggtgcaca
gatgaacccaatgaggcccttgaggcccaagacactaggcctgggctgcggctgcttctg
tggctggagcagaatctggaaagagtgcttcctcagccccccaaatcctctgaggtctgg
agagatgagcctgcagttgctacaggtgctgcctcagacccagcgcctccaggacgcccc
caggaaatggggcccaagctgcaggcccgggagaccccctccctgcccacacccatcccc
ctgcagcccaaggaggaacccaaggaggcaccagctccagagccccagcccggctcccag
gcccagacctcctccctgccaccaaccagggaccctgccaggctggtggcatgggtcctg
cacaggctggagatggccttgccgcagccagtgctacatgggaaaataggggaacaggag
cctgactcccctgggatatgtgatgtgcagaccatcagcatccttcctggaggacaagtg
gagcctgaccttgtcctagaggaggttgaaccgccctgggaggatgcccaccaggatgtc
agtaccagcccacagggtacagaggtggttccagcttatgaagaagagaacaaagctgtg
gagaagatgcccagagagctgtcccggattgaagaggagaaagaagatgaggaggaggaa
gaggaagaggaggaggaggaggaagaggaggaggtgactgaggtgctgctggatagctgt
gtggtgtcgcaggtgggcgtgggccagagtgaagaagacgggacccggccccagagcact
tcagatcagaagctgtgggaggaagttggggaggaggccaagaaggaggctgaagagaag
gccaaggaggaggccgaggaggtggctgaagaggaggctgaaaaggagccccaggactgg
gcggagaccaaggaggagcctgaggctgaggccgaggctgccagttcaggagtgcctgcc
acgaaacagcacccagaagtgcaggtggaagatactgatgctgatagctgccccctcatg
gcagaagagaatccaccctcaaccgtgttgccgccaccgtctcctgccaaatcagacacc
cttatagtcccaagctcagcctcggggacacacaggaagaagctgccctctgaggatgat
gaggctgaagagctcaaggcgttgtcaccagcagagtccccagtggttgcctggtctgac
cccaccaccccgaaggacactgatggccaggaccgtgcggcctccacggccagcacaaat
agcgccatcatcaacgaccggctccaggagctggtgaagctcttcaaggagcggacagag
aaagtgaaggagaaactcattgaccctgacgtcacctctgatgaggagagccccaagccc
tccccagccaagaaagccccagagccagctccagacacaaagcccgctgaagccgagcca
gtggaagaggagcactattgcgacatgctctgctgcaagttcaaacaccgcccctggaag
aagtaccagtttccccagagcattgacccgctgaccaacctgatgtatgtcctatggctg
ttcttcgtggtgatggcctggaattggaactgttggctgattcccgtgcgctgggccttc
ccctaccagaccccggacaacatccaccactggctgctgatggattacctatgcgacctc
atctacttcctggacatcaccgtgttccagacacgcctgcagtttgtcagaggcggggac
atcattacggacaaaaaggacatgcgaaataactacctgaagtctcgccgcttcaagatg
gacctgctcagcctcctgcccttggattttctctatttgaaagtcggtgtgaaccccctc
ctccgcctgccccgctgtttaaagtacatggccttcttcgagtttaacagccgcctggaa
tccatcctcagcaaagcctacgtgtacagggtcatcaggaccacagcctaccttctctac
agcctgcatttgaattcctgtctttattactgggcatcggcctatcagggcctcggctcc
actcactgggtttacgatggcgtgggaaacagttatattcgctgttactactttgctgtg
aagaccctcatcaccatcggggggctgcctgaccccaagacactctttgaaattgtcttc
cagctgctgaattatttcacgggcgtctttgctttctctgtgatgatcggacagatgaga
gatgtggtaggggccgccaccgccggacagacctactaccgcagctgcatggacagcacg
gtgaagtacatgaatttctacaagatccccaagtccgtgcagaaccgcgtcaagacctgg
tacgagtacacctggcactcgcaaggcatgctggatgagtcagagctgatggtgcagctt
ccagacaagatgcggctggacctcgccatcgacgtgaactacaacatcgttagcaaagtc
gcactctttcagggctgtgaccggcagatgatctttgacatgctgaagaggcttcgctct
gttgtctacctgcccaacgactatgtgtgcaagaagggggagatcggccgtgagatgtac
atcatccaggcagggcaagtgcaggtcttgggcggccctgatgggaaatctgtgctggtg
acgctgaaagctggatctgtgtttggagaaataagcttgctggctgttgggggcgggaac
cggcgcacggccaacgtggtggcgcacgggtttaccaacctcttcatcctggataagaag
gacctgaatgagattttggtgcattatcctgagtctcagaagttactccggaagaaagcc
aggcgcatgctgagaagcaacaataagcccaaggaggagaagagcgtgctgatccttcca
ccccgggcgggcaccccaaagctcttcaacgctgccctcgctatgacaggaaagatgggt
ggcaagggggcaaaaggcggcaaacttgctcacctccgggcccggctcaaagaactggcc
gcgctggaggcggctgcaaagcagcaagagttggtggaacaggccaagagctcgcaagac
gtcaagggagaggaaggctccgccgccccagaccagcacacgcacccaaaggaggccgcc
accgacccacccgcgccccggacgccccccgagcccccggggtctccaccgagctctcca
ccgcctgcctcccttgggaggccggagggagaggaggaggggccggccgagcccgaagag
cactcggtgaggatctgcatgagcccgggcccggagccgggagagcagatcctgtcggtg
aagatgccggaggaaagggaggagaaggcggagtaa

KEGG   Homo sapiens (human): 1260
Entry
1260              CDS       T01001                                 

Gene name
CNGA2, CNCA, CNCA1, CNG2, OCNC1, OCNCALPHA, OCNCa
Definition
(RefSeq) cyclic nucleotide gated channel subunit alpha 2
  KO
K04949  cyclic nucleotide gated channel alpha 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1260 (CNGA2)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    1260 (CNGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1260 (CNGA2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1260 (CNGA2)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding Ion_trans_2 Snapin_Pallidin
Other DBs
NCBI-GeneID: 1260
NCBI-ProteinID: NP_005131
OMIM: 300338
HGNC: 2149
Ensembl: ENSG00000183862
Vega: OTTHUMG00000024173
Pharos: Q16280(Tbio)
UniProt: Q16280 B3KXY3
LinkDB
Position
Xq28
AA seq 664 aa
MTEKTNGVKSSPANNHNHHAPPAIKANGKDDHRTSSRPHSAADDDTSSELQRLADVDAPQ
QGRSGFRRIVRLVGIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQEGDGKGDKDGE
DKGTKKKFELFVLDPAGDWYYCWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDY
VSDVVYIADLFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDVASIIPTDLIYFAVDI
HSPEVRFNRLLHFARMFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKGMEAKVIRWFDYLWTNK
KTVDEREILKNLPAKLRAEIAINVHLSTLKKVRIFHDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEK
LGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAA
ADEP
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaccgaaaaaaccaatggtgtgaagagctccccagccaataatcacaaccatcatgca
cctcctgccatcaaggccaatggcaaagatgaccacaggacaagcagcaggccacactct
gcagctgacgatgacacctcctcagaactgcagaggctggcagacgtggatgccccacag
cagggaaggagtggcttccgcaggatagttcgcctggtggggatcatcagagaatgggcc
aacaagaatttccgagaggaggaacctaggcctgactcattcctcgagcgttttcgtggg
cctgaactccagactgtgaccacacaggagggggatggcaaaggcgacaaggatggcgag
gacaaaggcaccaagaagaaatttgaactatttgtcttggacccagctggggattggtac
tactgctggctatttgtcattgccatgcccgtcctttacaactggtgcctgctggtggcc
agagcctgcttcagtgacctacagaaaggctactacctggtgtggctggtgctggattat
gtctcagatgtggtctacattgcggacctcttcatccgattgcgcacaggtttcctggag
caggggctgctggtcaaagataccaagaaactgcgagacaactacatccacaccctgcag
ttcaagctggatgtggcttccatcatccccactgacctgatctattttgctgtggacatc
cacagccctgaggtgcgcttcaaccgcctgctgcactttgcccgcatgtttgagttcttt
gaccggacagagacacgcaccaactaccctaacatcttccgcatcagcaaccttgtcctc
tacatcttggtcatcatccactggaatgcctgcatctattatgccatctccaaatccata
ggctttggggtcgacacctgggtttacccaaacatcactgaccctgagtatggctacctg
gctagggaatacatctattgcctttactggtccacactgactctcactaccattggggag
acaccaccccctgtaaaggatgaggagtacctatttgtcatctttgacttcctgattggc
gtcctcatctttgccaccatcgtgggaaatgtgggctccatgatctccaacatgaatgcc
acccgggcagagttccaggctaagatcgatgccgtgaaacactacatgcagttccgaaag
gtcagcaaggggatggaagccaaggtcattaggtggtttgactacttgtggaccaataag
aagacagtggatgagcgagaaattctcaagaatctgccagccaagctcagggctgagata
gccatcaatgtccacttgtccacactcaagaaagtgcgcatcttccatgattgtgaggct
ggcctgctggtagagctggtactgaaactccgtcctcaggtcttcagtcctggggattac
atttgccgcaaaggggacatcggcaaggagatgtacatcattaaggagggcaaactggca
gtggtggctgatgatggtgtgactcagtatgctctgctgtcggctggaagctgctttggc
gagatcagtatccttaacattaagggcagtaaaatgggcaatcgacgcacagctaatatc
cgcagcctgggctactcagatctcttctgcttgtccaaggatgatcttatggaagctgtg
actgagtaccctgatgccaagaaagtcctagaagagaggggtcgggagatcctcatgaag
gagggactgctggatgagaacgaagtggcaaccagcatggaggtcgacgtgcaggagaag
ctagggcagctggagaccaacatggaaaccttgtacactcgctttggccgcctgctggct
gagtacacgggggcccagcagaagctcaagcagcgcatcacagttctggaaaccaagatg
aaacagaacaatgaagatgactacctgtctgatgggatgaacagccctgagctggctgct
gctgacgagccataa

KEGG   Homo sapiens (human): 1262
Entry
1262              CDS       T01001                                 

Gene name
CNGA4, CNCA2, CNG-4, CNG4, CNG5, CNGB2, OCNC2, OCNCBETA, OCNCb
Definition
(RefSeq) cyclic nucleotide gated channel subunit alpha 4
  KO
K04951  cyclic nucleotide gated channel alpha 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1262 (CNGA4)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    1262 (CNGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1262 (CNGA4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1262 (CNGA4)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding
Other DBs
NCBI-GeneID: 1262
NCBI-ProteinID: NP_001032406
OMIM: 609472
HGNC: 2152
Ensembl: ENSG00000132259
Vega: OTTHUMG00000165379
Pharos: Q8IV77(Tdark)
UniProt: Q8IV77
LinkDB
Position
11p15.4
AA seq 575 aa
MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPD
LQHGYLVAWLVLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLA
SLMPTDVVYVRLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAR
EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPEDLAEADDEGEPEEGTSKDEEGRASQEGPPGPE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgagccaggacaccaaagtgaagacaacagagtccagtcccccagccccatccaaggcc
aggaagttgctgcctgtcctggacccatctggggattactactactggtggctgaacaca
atggtcttcccagtcatgtataacctcatcatcctcgtgtgcagagcctgcttccccgac
ttgcagcacggttatctggtggcctggttggtgctggactacacgagtgacctgctatac
ctactagacatggtggtgcgcttccacacaggattcttggaacagggcatcctggtggtg
gacaagggtaggatctcgagtcgctacgttcgcacctggagtttcttcttggacctggct
tccctgatgcccacagatgtggtctacgtgcggctgggcccgcacacacccaccctgagg
ctgaaccgctttctccgcgcgccccgcctcttcgaggccttcgaccgcacagagacccgc
acagcttacccaaatgcctttcgcattgccaagctgatgctttacatttttgtcgtcatc
cattggaacagctgcctatactttgccctatcccggtacctgggcttcgggcgtgacgca
tgggtgtacccggaccccgcgcagcctggctttgagcgcctgcggcgccagtacctctat
agcttttacttctccacgctgatactgactacagtgggcgatacaccgccgccagccagg
gaagaagagtacctcttcatggtgggcgacttcctgctggccgtcatgggtttcgccacc
atcatgggtagcatgagctctgtcatctacaacatgaacactgcagatgcggctttctac
ccagatcatgcactggtgaagaagtacatgaagctgcagcacgtcaaccgcaagctggag
cggcgagttattgactggtatcagcacctgcagatcaacaagaagatgaccaacgaggta
gccatcttacagcacttgcctgagcggctgcgggcagaagtggctgtgtctgtgcacctg
tccactctgagccgggtgcagatctttcagaactgtgaggccagcctgctggaggagctg
gtgctgaagctgcagccccagacctactcaccaggtgaatatgtatgccgcaaaggagac
attggccaagagatgtacatcatccgagagggtcaactggccgtggtggcagatgatggt
atcacacagtatgctgtgctcggtgcagggctctactttggggagatcagcatcatcaac
atcaaagggaacatgtctgggaaccgccgcacagccaacatcaagagcctaggttattca
gacctattctgcctgagcaaggaggacctgcgggaggtgctgagcgagtatccacaagca
cagaccatcatggaggagaaaggacgtgagatcctgctgaaaatgaacaagttggacgtg
aatgctgaggcagctgagatcgccctgcaggaggccacagagtcccggctacgaggccta
gaccagcagctggatgatctacagaccaagtttgctcgcctcctggctgagctggagtcc
agcgcacttaagattgcttaccgcattgaacggctggagtggcagactcgagagtggcca
atgcccgaggacctggctgaggctgatgacgagggtgagcctgaggagggaacttccaaa
gatgaagagggcagggccagccaggagggacccccaggtccagagtga

DBGET integrated database retrieval system