KEGG   Homo sapiens (human): 1317
Entry
1317              CDS       T01001                                 

Gene name
SLC31A1, COPT1, CTR1
Definition
(RefSeq) solute carrier family 31 member 1
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    1317 (SLC31A1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    1317 (SLC31A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    1317 (SLC31A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   1317 (SLC31A1)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 1317
NCBI-ProteinID: NP_001850
OMIM: 603085
HGNC: 11016
Ensembl: ENSG00000136868
Vega: OTTHUMG00000020519
Pharos: O15431(Tbio)
UniProt: O15431 A0A024R824
LinkDB
Structure
PDB: 
2LS2 2LS3 2LS4

Position
9q32
AA seq 190 aa
MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSG
LVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETH
KTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKA
VVVDITEHCH
NT seq 573 nt   +upstreamnt  +downstreamnt
atggatcattcccaccatatggggatgagctatatggactccaacagtaccatgcaacct
tctcaccatcacccaaccacttcagcctcacactcccatggtggaggagacagcagcatg
atgatgatgcctatgaccttctactttggctttaagaatgtggaactactgttttccggt
ttggtgatcaatacagctggagaaatggctggagcttttgtggcagtgtttttactagca
atgttctatgaaggactcaagatagcccgagagagcctgctgcgtaagtcacaagtcagc
attcgctacaattccatgcctgtcccaggaccaaatggaaccatccttatggagacacac
aaaactgttgggcaacagatgctgagctttcctcacctcctgcaaacagtgctgcacatc
atccaggtggtcataagctacttcctcatgctcatcttcatgacctacaacgggtacctc
tgcattgcagtagcagcaggggccggtacaggatacttcctcttcagctggaagaaggca
gtggtagtggatatcacagagcattgccattga

DBGET integrated database retrieval system