KEGG   Homo sapiens (human): 1384
Entry
1384              CDS       T01001                                 

Gene name
CRAT, CAT, CAT1, NBIA8
Definition
(RefSeq) carnitine O-acetyltransferase
  KO
K00624  carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00833  Neurodegeneration with brain iron accumulation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    1384 (CRAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.7  carnitine O-acetyltransferase
     1384 (CRAT)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 1384
NCBI-ProteinID: NP_000746
OMIM: 600184
HGNC: 2342
Ensembl: ENSG00000095321
Vega: OTTHUMG00000147343
LinkDB
Structure
PDB: 
1NM8 1S5O

Position
9q34.11
AA seq 626 aa
MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSE
EEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSP
GVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSC
RVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSS
LQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVY
RSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIE
YTKKPELVRSPLVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKD
FPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVK
AMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMD
TSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNA
ARLAHYLEKALLDMRALLQSHPRAKL
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgttagccttcgctgccaggaccgtggtgaagcctctgggcttcctgaagcccttctcc
ttgatgaaggcttccagccgcttcaaggcacaccaggatgcactgccacggctgcccgtg
ccccctctccagcagtccctggaccactacctgaaggcgctgcagcccatcgtgagtgag
gaggagtgggcccacaccaagcagctggtggatgagtttcaggcctcaggaggtgtaggg
gagcgcctgcagaaggggctggagcgtcgggccaggaagacggagaactggctgtctgag
tggtggctcaagaccgcctacctccagtaccgccagcctgtggtcatctactcgagccca
ggcgtgatgctacccaagcaggacttcgtggacctgcagggtcagctccgatttgctgcc
aaactcattgagggtgtgttggatttcaaggtcatgattgacaacgagaccctgcccgtg
gagtacctgggggggaagccactgtgcatgaaccagtactatcagatcttgtcctcctgc
cgagtgccgggccccaagcaggacacagtcagcaacttcagcaagaccaagaagcctccc
acgcacatcaccgtggtacacaactaccagttttttgagctggatgtgtaccacagtgac
gggacacccctcactgcggatcagatctttgtgcagctggagaagatctggaactcatcc
ctacagaccaacaaggagcctgtgggcatcctcacctccaaccaccgcaactcctgggcc
aaggcatacaacaccctcatcaaagacaaggtgaaccgggattccgtgcgctccatccag
aagagcatcttcaccgtgtgcctagatgcaaccatgcccagggtctcagaagacgtgtac
cgcagccacgtggcaggccagatgctgcatgggggcggcagcaggctcaacagcggcaac
cgctggttcgacaagacgctgcagttcatcgtggcagaagatggctcctgtgggcttgtg
tacgagcatgctgcagcggaggggccccctattgtcacccttctggactatgtcatcgag
tacacgaagaaacccgagcttgtgcggtctcccctggtgcccctgcccatgcccaagaag
ctgcggttcaacatcacccccgagatcaagagcgacatcgagaaggccaagcagaacctc
agcatcatgatccaggacctggatatcaccgtgatggtgttccaccattttggaaaagac
ttccccaagtcggagaagctaagcccagatgccttcatccagatggctttgcagctggcc
tactacaggatctacggacaggcatgtgccacctatgaaagtgcctccctgcgcatgttt
cacctgggccgcaccgacaccatccgctcggcttccatggactcactcacctttgtcaag
gccatggatgactccagcgtcacggagcaccagaaggtggagctgctgcggaaggccgtg
caggcccaccgaggctacaccgaccgggccatccgcggggaggcctttgatcgacacctg
ctgggcctgaagctgcaggccatcgaggacctggtgagcatgcccgacatcttcatggac
acctcctacgccatcgccatgcacttccacctctccaccagccaggtccctgccaagaca
gactgtgtcatgttcttcgggcccgtggtccccgacggctacggtgtctgctataacccc
atggaggcccacatcaacttctccctgtcggcctacaacagctgcgcggagaccaacgcc
gcccgcctggcgcattacctggagaaggcgctcctggacatgcgtgccctgctgcagagc
cacccccgggccaagctctga

DBGET integrated database retrieval system