KEGG   Homo sapiens (human): 2071Help
Entry
2071              CDS       T01001                                 

Gene name
ERCC3, BTF2, GTF2H, RAD25, TFIIH, TTD2, XPB
Definition
(RefSeq) ERCC excision repair 3, TFIIH core complex helicase subunit
  KO
K10843  DNA excision repair protein ERCC-3 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
Module
hsa_M00290  Holo-TFIIH complex
Disease
H00403  Disorders of nucleotide excision repair
H00866  Trichothiodystrophy
H01428  Xeroderma pigmentosum (XP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2071 (ERCC3)
  Replication and repair
   03420 Nucleotide excision repair
    2071 (ERCC3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     2071 (ERCC3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2071 (ERCC3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     2071 (ERCC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERCC3_RAD25_C Helicase_C_3 ResIII Helicase_C SNF2_N DEAD
Motif
Other DBs
NCBI-GeneID: 2071
NCBI-ProteinID: NP_000113
OMIM: 133510
HGNC: 3435
Ensembl: ENSG00000163161
Vega: OTTHUMG00000131530
Pharos: P19447(Tbio)
UniProt: P19447
LinkDB All DBs
Structure
PDB: 

Position
2q14.3
AA seq 782 aa AA seqDB search
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESC
HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND
SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR
CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS
WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK
FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP
KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY
SLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRF
RK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagagaccgagcggaccgcgacaagaagaaatccaggaagcggcactatgag
gatgaagaggatgatgaagaggacgccccggggaacgaccctcaggaagcggttccctcg
gcggcggggaagcaggtggatgagtcaggcaccaaagtggatgaatatggagccaaggac
tacaggctgcaaatgccgctgaaggacgaccacacctccaggcccctctgggtggctccc
gatggccatatcttcttggaagccttctctccagtttacaaatatgcccaagacttcttg
gtggctattgcagagccagtgtgccgaccaacccatgtgcatgagtacaaactaactgcc
tactccttgtatgcagctgtcagcgttgggctgcaaaccagtgacatcaccgagtacctc
aggaagctcagcaagactggagtccctgatggaattatgcagtttattaagttgtgtact
gtcagctatggaaaagtcaagctggtcttgaagcacaacagatacttcgttgaaagttgc
caccctgatgtaatccagcatcttctccaggaccccgtgatccgagaatgccgcttaaga
aactctgaaggggaggccactgagctcatcacagagactttcacaagcaaatctgccatt
tctaagactgctgaaagcagtggtgggccctccacttcccgagtgacagatccacagggt
aaatctgacatccccatggacctgtttgacttctatgagcaaatggacaaggatgaagaa
gaagaagaagagacacagacagtgtcttttgaagtcaagcaggaaatgattgaggaactc
cagaaacgttgcatccacctggagtaccctctgttggcagaatatgacttccggaatgat
tctgtcaaccctgatatcaacattgacctaaagcccacagctgtcctcagaccctatcag
gagaagagcttgcgaaagatgtttggaaacgggcgtgcacgttcgggggtcattgttctt
ccctgcggtgctggaaagtccctggttggtgtgactgctgcatgcactgtcagaaaacgc
tgtctggtgctgggcaactcagctgtttctgtggagcagtggaaagcccagttcaagatg
tggtccaccattgacgacagccagatctgccggttcacctccgatgccaaggacaagccc
atcggctgctccgttgccattagcacctactccatgctgggccacaccaccaaaaggtcc
tgggaggccgagcgagtcatggagtggctcaagacccaggagtggggcctcatgatcctg
gatgaagtgcacaccataccagccaagatgttccgaagggtgctcaccatcgtgcaggcc
cactgtaagctgggtttgactgcgaccctcgtccgcgaagatgacaaaattgtggattta
aattttctgattgggcctaagctctacgaagccaactggatggagctgcagaataatggc
tacatcgccaaagtccagtgtgctgaggtctggtgccctatgtctcctgaattttaccgg
gaatatgtggcaatcaaaaccaagaaacgaatcttgctgtacaccatgaaccccaacaaa
tttagagcttgccagtttctgatcaagtttcatgaaaggaggaatgacaagattattgtc
tttgctgacaatgtgtttgccctaaaggaatatgccattcgactgaacaaaccctatatc
tacggacctacgtctcagggggaaaggatgcaaattctccagaatttcaagcacaacccc
aaaattaacaccatcttcatatccaaggtaggtgacacttcgtttgatctgccggaagca
aatgtcctcattcagatctcatcccatggtggctccaggcgtcaggaagcccaaaggcta
gggcgggtgcttcgagctaaaaaagggatggttgcagaagagtacaatgcctttttctac
tcactggtatcccaggacacacaggaaatggcttactcaaccaagcggcagagattcttg
gtagatcaaggttatagcttcaaggtgatcacgaaactcgctggcatggaggaggaagac
ttggcgttttcgacaaaagaagagcaacagcagctcttacagaaagtcctggcagccact
gacctggatgccgaggaggaggtggtggctggggaatttggctccagatccagccaggca
tctcggcgctttggcaccatgagttctatgtctggggccgacgacactgtgtacatggag
taccactcatcgcggagcaaggcgcccagcaaacatgtacacccgctcttcaagcgcttt
aggaaatga

DBGET integrated database retrieval system