KEGG   Homo sapiens (human): 2209Help
Entry
2209              CDS       T01001                                 

Gene name
FCGR1A, CD64, CD64A, FCRI, IGFR1
Definition
(RefSeq) Fc fragment of IgG receptor Ia
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2209 (FCGR1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2209 (FCGR1A)
   04666 Fc gamma R-mediated phagocytosis
    2209 (FCGR1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    2209 (FCGR1A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2209 (FCGR1A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    2209 (FCGR1A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    2209 (FCGR1A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2209 (FCGR1A)
   05152 Tuberculosis
    2209 (FCGR1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2209 (FCGR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2209 (FCGR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2209 (FCGR1A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2209 (FCGR1A)
CD molecules [BR:hsa04090]
 Proteins
  2209 (FCGR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set Ig_4 PIRT Adeno_E3_CR1 SID-1_RNA_chan
Motif
Other DBs
NCBI-GeneID: 2209
NCBI-ProteinID: NP_000557
OMIM: 146760
HGNC: 3613
Ensembl: ENSG00000150337
Vega: OTTHUMG00000012089
Pharos: P12314(Tchem)
UniProt: P12314
LinkDB All DBs
Structure
PDB: 

Position
1q21.2
AA seq 374 aa AA seqDB search
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
TSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG
IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQ
LQEGVHRKEPQGAT
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcttgacaactctgctcctttgggttccagttgatgggcaagtggacaccaca
aaggcagtgatcactttgcagcctccatgggtcagcgtgttccaagaggaaaccgtaacc
ttgcactgtgaggtgctccatctgcctgggagcagctctacacagtggtttctcaatggc
acagccactcagacctcgacccccagctacagaatcacctctgccagtgtcaatgacagt
ggtgaatacaggtgccagagaggtctctcagggcgaagtgaccccatacagctggaaatc
cacagaggctggctactactgcaggtctccagcagagtcttcacggaaggagaacctctg
gccttgaggtgtcatgcgtggaaggataagctggtgtacaatgtgctttactatcgaaat
ggcaaagcctttaagtttttccactggaattctaacctcaccattctgaaaaccaacata
agtcacaatggcacctaccattgctcaggcatgggaaagcatcgctacacatcagcagga
atatctgtcactgtgaaagagctatttccagctccagtgctgaatgcatctgtgacatcc
ccactcctggaggggaatctggtcaccctgagctgtgaaacaaagttgctcttgcagagg
cctggtttgcagctttacttctccttctacatgggcagcaagaccctgcgaggcaggaac
acatcctctgaataccaaatactaactgctagaagagaagactctgggttatactggtgc
gaggctgccacagaggatggaaatgtccttaagcgcagccctgagttggagcttcaagtg
cttggcctccagttaccaactcctgtctggtttcatgtccttttctatctggcagtggga
ataatgtttttagtgaacactgttctctgggtgacaatacgtaaagaactgaaaagaaag
aaaaagtgggatttagaaatctctttggattctggtcatgagaagaaggtaatttccagc
cttcaagaagacagacatttagaagaagagctgaaatgtcaggaacaaaaagaagaacag
ctgcaggaaggggtgcaccggaaggagccccagggggccacgtag

DBGET integrated database retrieval system