KEGG   Homo sapiens (human): 23414
Entry
23414             CDS       T01001                                 

Gene name
ZFPM2, DIH3, FOG2, SRXY9, ZC2HC11B, ZNF89B, hFOG-2
Definition
(RefSeq) zinc finger protein, FOG family member 2
  KO
K17442  zinc finger protein ZFPM2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Disease
H00549  Tetralogy of Fallot
H00607  46,XY gonadal dysgenesis
H01241  Congenital diaphragmatic hernia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    23414 (ZFPM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    23414 (ZFPM2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    23414 (ZFPM2)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-C2H2 zf-C2H2_4 zf-met zf-C2H2_8
Other DBs
NCBI-GeneID: 23414
NCBI-ProteinID: NP_036214
OMIM: 603693
HGNC: 16700
Ensembl: ENSG00000169946
Vega: OTTHUMG00000164818
Pharos: Q8WW38(Tbio)
UniProt: Q8WW38 Q9NPQ0
LinkDB
Position
8q23.1
AA seq 1151 aa
MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEV
EYFCNKGDDEGIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQL
PVGTTWGPFPGKMDLNNNSLKTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQ
LWCTTTKAISEGEELIAFVVDFDSRLQAASQMTLTEGMYPARLLDSIQLLPQQAAMASIL
PTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREAAPVSEENEDSAHQISSLCPF
PQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINFHQHLFSHLTQ
AAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSEL
PQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLA
SSPVQPNIGPSFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIY
SPLMPKGATCFECNITFNNLDNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTG
QTSINLLNPAAHSADPENPLLQTSCINSSTVLDLIGPNGKGHDKDFSTQTKKLSTSSNND
DKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHETYMVHKQYYCATRHDPPLKR
SASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDVANLNNPCTSTQEPTEGL
GECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQS
ERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPES
ERNSPDVSYERSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRH
LFLPQCLYPGAIKKAKGADQLSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQAS
SNGCAALKKDSLPLLPKNRGMVIVNGGLKQDERPAANPQQENISQNPQHEDDHKSPSWIS
ENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCDIQFNNLSNFITHKKF
YCSSHAAEHVK
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgtcccggcgaaagcaaagcaaaccccggcagatcaaacggccgcttgaagatgccatt
gaagatgaggaagaagaatgtccatcagaggaaacagacatcatctccaaaggagacttt
ccattggaggaaagcttttccacagaatttgggcctgaaaatctgagctgcgaagaagtg
gaatacttttgtaacaaaggtgatgatgaaggaatccaggagacagcagaatcagatggg
gacacacagtcagagaaaccggggcaacctggagttgagacagacgactgggatggacca
ggagagctggaggtgtttcagaaagatggggaacgaaaaattcagagtcgacagcaactt
ccagtgggaacaacctgggggccgtttcctgggaagatggacttgaataataattctttg
aagacaaaggctcaggtcccaatggtgctgactgctggtcccaagtggttgctggatgtg
acttggcaaggagtggaagacaacaaaaacaactgcattgtgtacagcaaagggggtcag
ctttggtgtacaactacgaaggccatctctgagggtgaagagctaattgcctttgtggtg
gattttgactcaaggctacaagctgccagtcagatgactctcacagaagggatgtaccct
gcacgcctgctggactcaattcagctgcttcctcagcaagctgccatggcttctattttg
cccacagctattgtcaataaggatatattcccttgcaagtcctgtggcatctggtatcgg
agtgagcggaatctgcaggcccatttgatgtactactgcagtgggaggcaaagagaagct
gctccggtgtcagaggaaaatgaagacagtgcccatcagatttccagcctgtgccccttc
ccacagtgcaccaagagcttttcaaatgctcgagctctagaaatgcacctgaattcacac
agtggagtgaaaatggaagaattcctgccccctggtgctagtctaaaatgcaccgtctgt
agctacactgctgattccgtgatcaactttcaccaacacctgttctcccatctcactcaa
gctgccttccgatgtaatcactgccatttcggcttccagactcagagggagttattgcag
caccaggagctccatgtccctagcggcaaacttcccagagaaagtgacatggaacactct
ccaagtgcaactgaagacagcttacagccagccacagacttattgaccagaagcgaactt
ccccagagccaaaaggccatgcagactaaagatgcgagctctgacacagagctggacaag
tgtgagaaaaagactcagctctttctcacgaaccagagaccagagatacagcctacaaca
aataaacaaagcttttcttacacaaaaataaagtctgagccctctagcccaagacttgcc
tcatctccagttcagcctaatattgggccttctttccctgtgggccctttcctatctcag
ttttctttcccccaagatatcaccatggtccctcaagcttcagagatcttagctaagatg
tctgaactggtgcatcggcgactgaggcatggcagtagtagctaccctcccgtcatttac
agccctttgatgcccaagggggctacttgttttgagtgtaacataacattcaataatttg
gataattatctagtgcacaaaaagcattattgcagcagccgatggcagcagatggctaag
tccccagagttccctagtgtgtcagaaaagatgcctgaagctttgagtcccaacactggc
caaacctccataaaccttctcaacccagctgctcattctgctgatcctgagaatccactt
cttcaaacatcttgcatcaattcttccactgtcttagatttaattgggccaaatgggaag
ggccatgacaaggacttttccactcaaactaagaagctctccacctccagtaacaatgat
gacaaaattaatggaaaacctgttgatgtgaaaaatcccagtgtccccttagtggatggg
gaaagtgacccaaataagactacctgtgaagcttgcaacattaccttcagccggcacgaa
acatacatggtccacaaacagtattactgtgctacacgccacgaccctccactgaagagg
tctgcttccaacaaagtgcctgccatgcagagaaccatgcgcacacgcaagcgcagaaag
atgtatgagatgtgcctacctgagcaggaacaaaggcctccactggttcagcagagattt
cttgacgtagccaacctcaataatccttgtacctccactcaagaacccacagaagggcta
ggagagtgctaccacccaagatgtgatatctttccaggaattgtctctaaacacttggaa
acttctctgacgatcaacaagtgtgttccagtttccaaatgtgatactactcattccagt
gtttcctgcctagagatggacgtgcccatagatctcagcaaaaagtgtttatctcagtct
gagcggacgaccacgtctcccaaaaggctgctggactatcacgagtgcactgtgtgcaag
atcagtttcaataaggtagaaaactatctggcccacaagcagaatttctgcccggttact
gcacatcagcgtaatgacctgggtcaactggacggcaaagtgtttccgaatccagaaagc
gaacgaaacagccctgatgtcagctacgaaagaagcataataaaatgtgagaaaaatggg
aatttgaagcagccttcccccaatggaaacttattttcatcccacctagcaaccctgcaa
ggcttgaaggtctttagtgaagctgctcagctcattgctacaaaagaagaaaacagacat
ttgtttcttccacaatgcctttaccctggagcaataaagaaagcaaaaggagccgaccag
ctttctccatattatggaatcaagccaagtgattatatttctggttctcttgtcatccat
aacactgacatcgagcaaagcagaaatgcagaaaatgaatctcctaaaggccaggcttcc
tcaaatgggtgtgctgcgctgaagaaagattctctgccattgttgcccaaaaatcgagga
atggtaatagtgaatggtggactgaaacaagatgagagacctgctgccaacccacagcaa
gagaacatttcccagaatcctcagcacgaagacgaccacaaatctccctcgtggatctct
gagaacccattagctgccaatgagaatgtctcaccaggaattccctcagcagaggaacag
ttgtctagtatagcaaaaggtgtgaatggttccagccaggctccaaccagtgggaaatat
tgccggctatgtgatatccagttcaacaacctttcaaactttataactcacaagaagttt
tattgctcatcacatgcagcagaacatgtcaaatga

DBGET integrated database retrieval system