KEGG   Homo sapiens (human): 284098Help
Entry
284098            CDS       T01001                                 

Gene name
PIGW, Gwt1, HPMRS5
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class W
  KO
K05283  glucosaminylphosphatidylinositol acyltransferase [EC:2.3.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Network
nt06018  GPI-anchor biosynthesis
  Element
N00748  GPI-anchor biosynthesis
N00749  PGAP1 deficiency in GPI-anchor biosynthesis
N00750  PIGT deficiency in GPI-anchor biosynthesis
N00751  PIGO deficiency in GPI-anchor biosynthesis
N00752  PIGN deficiency in GPI-anchor biosynthesis
N00753  PIGV deficiency in GPI-anchor biosynthesis
N00754  PIGM deficiency in GPI-anchor biosynthesis
N00755  PIGW deficiency in GPI-anchor biosynthesis
Disease
H01488  Hyperphosphatasia with mental retardation syndrome
H01489  Inherited glycosylphosphatidylinositol deficiencies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    284098 (PIGW)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.-  Acyltransferases
    2.3.-.-  
     284098 (PIGW)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GWT1 Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 284098
NCBI-ProteinID: NP_001333683
OMIM: 610275
HGNC: 23213
Ensembl: ENSG00000277161
Vega: OTTHUMG00000188438
Pharos: Q7Z7B1(Tdark)
UniProt: Q7Z7B1
LinkDB All DBs
Position
17q12
AA seq 504 aa AA seqDB search
MSEKQMKEAFVSNLNGTTVLEITQGLCFPAFCILCRGFLIIFSQYLCSFSPTWKTRFLTD
FVVLIVPMVATLTIWASFILLELLGVIIFGAGLLYQIYRRRTCYARLPFLKILEKFLNIS
LESEYNPAISCFRVITSAFTAIAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFVFGSAM
VCLEVRRRKYMEGSKLHYFTNSLYSVWPLVFLGIGRLAIIKSIGYQEHLTEYGVHWNFFF
TIIVVKLITPLLLIIFPLNKSWIIALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLN
ANREGIISTLGYVAIHMAGVQTGLYMHKNRSHIKDLIKVACFLLLAAISLFISLYVVQVN
VEAVSRRMANLAFCIWIVASSLILLSSLLLGDIILSFAKFLIKGALVPCSWKLIQSPVTN
KKHSESLVPEAERMEPSLCLITALNRKQLIFFLLSNITTGLINLMVDTLHSSTLWALFVV
NLYMFSNCLIVYVLYLQDKTVQFW
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagcagatgaaggaagcttttgtcagtaacctcaatggaaccaccgtgctg
gaaatcacccagggattgtgctttcctgcattctgtatcctgtgcagagggttcctgatc
attttctcacagtacttgtgttctttttcacctacctggaaaactagattcctcactgac
tttgttgtcctaatagttcccatggtagccactttgaccatttgggcttcatttatcctc
cttgagcttctcggtgtaattatctttggggcagggctgttgtatcaaatataccgaagg
aggacctgctatgccagactgcctttcctaaaaatccttgaaaaattcttgaacatcagt
ctagaatcagaatacaatccagccatctcctgtttccgtgtaattaccagtgcgtttact
gctattgctattttggctgtggacttcccactttttcccagaagatttgccaaaactgag
ctctatgggacaggagcaatggattttggagtaggtggctttgtttttgggtctgcaatg
gtttgtctagaggtcaggaggagaaaatatatggaagggtccaaattgcattactttaca
aactcattgtactctgtttggccattagtcttcctaggaatcggacgattagccattata
aaatcaataggctatcaggaacatttaacagagtatggagttcactggaactttttcttt
accataatagttgtgaaattgataacaccactgctgttgattatttttcccctaaataag
tcctggattattgccctcggcattactgtattataccagctagcccttgactttacctca
ctgaagaggttaatattatatggcactgatggtagtggcacacgggttggtctattaaat
gccaaccgcgaaggaataatctctaccctggggtatgtggcaatacacatggctggtgtg
caaacagggttatatatgcataagaaccgatcacatatcaaagacttgataaaagtagcc
tgttttcttttactggcagctattagcctcttcatatctctttacgtagttcaagtaaat
gtagaagcagtatctcgaagaatggcaaatttagccttttgtatttggatagttgcttct
agcctgatccttcttagtagtttattactgggtgatataattttgagttttgccaaattt
ctaattaaaggagctctagtaccatgttcttggaaacttatccagtcacctgttacaaat
aaaaagcattcagaatctctagtccctgaagccgaaagaatggaacccagtctttgttta
atcacagctctaaacagaaaacagttaatatttttcttgctgtcaaatataacaactggc
ctgatcaacctgatggtagatacattacacagcagtaccttgtgggccttatttgtggtc
aatctctatatgttttccaactgtttaattgtatatgtactatatttgcaagataagact
gtacaattttggtga

DBGET integrated database retrieval system