KEGG   Homo sapiens (human): 3109Help
Entry
3109              CDS       T01001                                 

Gene name
HLA-DMB, D6S221E, RING7
Definition
(RefSeq) major histocompatibility complex, class II, DM beta
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
N00591  HSV gB to antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3109 (HLA-DMB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3109 (HLA-DMB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3109 (HLA-DMB)
   04612 Antigen processing and presentation
    3109 (HLA-DMB)
   04658 Th1 and Th2 cell differentiation
    3109 (HLA-DMB)
   04659 Th17 cell differentiation
    3109 (HLA-DMB)
   04672 Intestinal immune network for IgA production
    3109 (HLA-DMB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3109 (HLA-DMB)
   05322 Systemic lupus erythematosus
    3109 (HLA-DMB)
   05323 Rheumatoid arthritis
    3109 (HLA-DMB)
   05320 Autoimmune thyroid disease
    3109 (HLA-DMB)
   05321 Inflammatory bowel disease (IBD)
    3109 (HLA-DMB)
   05330 Allograft rejection
    3109 (HLA-DMB)
   05332 Graft-versus-host disease
    3109 (HLA-DMB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3109 (HLA-DMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3109 (HLA-DMB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3109 (HLA-DMB)
   05152 Tuberculosis
    3109 (HLA-DMB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3109 (HLA-DMB)
   05164 Influenza A
    3109 (HLA-DMB)
   05168 Herpes simplex virus 1 infection
    3109 (HLA-DMB)
   05169 Epstein-Barr virus infection
    3109 (HLA-DMB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3109 (HLA-DMB)
   05140 Leishmaniasis
    3109 (HLA-DMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3109 (HLA-DMB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3109 (HLA-DMB)
  Exosomal proteins of epithelial cells
   3109 (HLA-DMB)
  Exosomal proteins of breast milk
   3109 (HLA-DMB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set ig
Motif
Other DBs
NCBI-GeneID: 3109
NCBI-ProteinID: NP_002109
OMIM: 142856
HGNC: 4935
Ensembl: ENSG00000242574
Vega: OTTHUMG00000031176
Pharos: P28068(Tbio)
UniProt: P28068 A0A1V0E3P2
LinkDB All DBs
Structure
PDB: 

Position
6p21.32
AA seq 263 aa AA seqDB search
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENK
MAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVA
KTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHL
ALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISW
RRAGHSSYTPLPGSNYSEGWHIS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatcacattcctgccgctgctgctggggctcagcctgggctgcacaggagcaggtggc
ttcgtggcccatgtggaaagcacctgtctgttggatgatgctgggactccaaaggatttc
acatactgcatctccttcaacaaggatctgctgacctgctgggatccagaggagaataag
atggccccttgcgaatttggggtgctgaatagcttggcgaatgtcctctcacagcacctc
aaccaaaaagacaccctgatgcagcgcttgcgcaatgggcttcagaattgtgccacacac
acccagcccttctggggatcactgaccaacaggacacggccaccatctgtgcaagtagcc
aaaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc
tatccagcagaagtgactatcacgtggaggaagaacgggaagcttgtcatgcctcacagc
agtgcgcacaagactgcccagcccaatggagactggacataccagaccctctcccattta
gccttaaccccctcttacggggacacttacacctgtgtggtagagcacactggggctcct
gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct
gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtgtgatcagctgg
cggagagctggccactctagttacactcctcttcctgggtccaattattcagaaggatgg
cacatttcctag

DBGET integrated database retrieval system