KEGG   Homo sapiens (human): 329Help
Entry
329               CDS       T01001                                 

Gene name
BIRC2, API1, HIAP2, Hiap-2, MIHB, RNF48, c-IAP1, cIAP1
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05145  Toxoplasmosis
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Network
nt06123  TNF signaling (virus)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    329 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    329 (BIRC2)
   04064 NF-kappa B signaling pathway
    329 (BIRC2)
   04668 TNF signaling pathway
    329 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    329 (BIRC2)
   04215 Apoptosis - multiple species
    329 (BIRC2)
   04217 Necroptosis
    329 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    329 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    329 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    329 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    329 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    329 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    329 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    329 (BIRC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    329 (BIRC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    329 (BIRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 NikR_C zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 329
NCBI-ProteinID: NP_001157
OMIM: 601712
HGNC: 590
Ensembl: ENSG00000110330
Vega: OTTHUMG00000167325
Pharos: Q13490(Tchem)
UniProt: Q13490
LinkDB All DBs
Structure
PDB: 

Position
11q22.2
AA seq 618 aa AA seqDB search
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaactgcctcccaaagacttttcccaggtccctcgtatcaaaacattaagagt
ataatggaagatagcacgatcttgtcagattggacaaacagcaacaaacaaaaaatgaag
tatgacttttcctgtgaactctacagaatgtctacatattcaactttccccgccggggtg
cctgtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctgatgctggataactggaaactaggagacagtcctatt
caaaagcataaacagctatatcctagctgtagctttattcagaatctggtttcagctagt
ctgggatccacctctaagaatacgtctccaatgagaaacagttttgcacattcattatct
cccaccttggaacatagtagcttgttcagtggttcttactccagcctttctccaaaccct
cttaattctagagcagttgaagacatctcttcatcgaggactaacccctacagttatgca
atgagtactgaagaagccagatttcttacctaccatatgtggccattaacttttttgtca
ccatcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgc
tttgcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcagaacac
cggaggcattttcccaactgtccatttttggaaaattctctagaaactctgaggtttagc
atttcaaatctgagcatgcagacacatgcagctcgaatgagaacatttatgtactggcca
tctagtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aatgatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgaatgaaa
ggccaagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttg
tcaacttcagataccactggagaagaaaatgctgacccaccaattattcattttggacct
ggagaaagttcttcagaagatgctgtcatgatgaatacacctgtggttaaatctgccttg
gaaatgggctttaatagagacctggtgaaacaaacagttcaaagtaaaatcctgacaact
ggagagaactataaaacagttaatgatattgtgtcagcacttcttaatgctgaagatgaa
aaaagagaagaggagaaggaaaaacaagctgaagaaatggcatcagatgatttgtcatta
attcggaagaacagaatggctctctttcaacaattgacatgtgtgcttcctatcctggat
aatcttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaaca
cagatacctttacaagcgagagaactgattgataccattttggttaaaggaaatgctgcg
gccaacatcttcaaaaactgtctaaaagaaattgactctacattgtataagaacttattt
gtggataagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaa
caattgaggaggttgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttct
gttgtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaaga
aaatgccctatttgcaggggtataatcaagggtactgttcgtacatttctctcttaa

KEGG   Homo sapiens (human): 330Help
Entry
330               CDS       T01001                                 

Gene name
BIRC3, AIP1, API2, CIAP2, HAIP1, HIAP1, IAP-1, MALT2, MIHC, RNF49, c-IAP2
Definition
(RefSeq) baculoviral IAP repeat containing 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05145  Toxoplasmosis
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05222  Small cell lung cancer
Network
nt06123  TNF signaling (virus)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06240  Transcription
  Element
N00123  Amplified REL to transcription
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    330 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    330 (BIRC3)
   04668 TNF signaling pathway
    330 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    330 (BIRC3)
   04215 Apoptosis - multiple species
    330 (BIRC3)
   04217 Necroptosis
    330 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    330 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    330 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    330 (BIRC3)
   05202 Transcriptional misregulation in cancer
    330 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    330 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    330 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    330 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    330 (BIRC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    330 (BIRC3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    330 (BIRC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 OTT_1508_deam DUF2039
Motif
Other DBs
NCBI-GeneID: 330
NCBI-ProteinID: NP_001156
OMIM: 601721
HGNC: 591
Ensembl: ENSG00000023445
Vega: OTTHUMG00000167324
Pharos: Q13489(Tchem)
UniProt: Q13489
LinkDB All DBs
Structure
PDB: 

Position
11q22.2
AA seq 604 aa AA seqDB search
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagtagaaaacagcatattcttatcaaatttgatgaaaagcgccaacacgttt
gaactgaaatacgacttgtcatgtgaactgtaccgaatgtctacgtattccacttttcct
gctggggttcctgtctcagaaaggagtcttgctcgtgctggtttctattacactggtgtg
aatgacaaggtcaaatgcttctgttgtggcctgatgctggataactggaaaagaggagac
agtcctactgaaaagcataaaaagttgtatcctagctgcagattcgttcagagtctaaat
tccgttaacaacttggaagctacctctcagcctacttttccttcttcagtaacaaattcc
acacactcattacttccgggtacagaaaacagtggatatttccgtggctcttattcaaac
tctccatcaaatcctgtaaactccagagcaaatcaagatttttctgccttgatgagaagt
tcctaccactgtgcaatgaataacgaaaatgccagattacttacttttcagacatggcca
ttgacttttctgtcgccaacagatctggcaaaagcaggcttttactacataggacctgga
gacagagtggcttgctttgcctgtggtggaaaattgagcaattgggaaccgaaggataat
gctatgtcagaacacctgagacattttcccaaatgcccatttatagaaaatcagcttcaa
gacacttcaagatacacagtttctaatctgagcatgcagacacatgcagcccgctttaaa
acattctttaactggccctctagtgttctagttaatcctgagcagcttgcaagtgcgggt
ttttattatgtgggtaacagtgatgatgtcaaatgcttttgctgtgatggtggactcagg
tgttgggaatctggagatgatccatgggttcaacatgccaagtggtttccaaggtgtgag
tacttgataagaattaaaggacaggagttcatccgtcaagttcaagccagttaccctcat
ctacttgaacagctgctatccacatcagacagcccaggagatgaaaatgcagagtcatca
attatccattttgaacctggagaagaccattcagaagatgcaatcatgatgaatactcct
gtgattaatgctgccgtggaaatgggctttagtagaagcctggtaaaacagacagttcag
agaaaaatcctagcaactggagagaattatagactagtcaatgatcttgtgttagactta
ctcaatgcagaagatgaaataagggaagaggagagagaaagagcaactgaggaaaaagaa
tcaaatgatttattattaatccggaagaatagaatggcactttttcaacatttgacttgt
gtaattccaatcctggatagtctactaactgccggaattattaatgaacaagaacatgat
gttattaaacagaagacacagacgtctttacaagcaagagaactgattgatacgatttta
gtaaaaggaaatattgcagccactgtattcagaaactctctgcaagaagctgaagctgtg
ttatatgagcatttatttgtgcaacaggacataaaatatattcccacagaagatgtttca
gatctaccagtggaagaacaattgcggagactacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccatagtgtttattccttgtggtcatctagtagtatgcaaagat
tgtgctccttctttaagaaagtgtcctatttgtaggagtacaatcaagggtacagttcgt
acatttctttcatga

DBGET integrated database retrieval system