KEGG   Homo sapiens (human): 359
Entry
359               CDS       T01001                                 

Gene name
AQP2, AQP-CD, WCH-CD
Definition
(RefSeq) aquaporin 2
  KO
K09865  aquaporin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
Network
nt06326  AVP signaling
  Element
N00915  AVP-V2R-PKA signaling pathway
N00916  Mutation-inactivated AVP to AVP-V2R-PKA signaling pathway
N00917  Mutation-activated AVPR2 to AVP-V2R-PKA signaling pathway
Disease
H00252  Congenital nephrogenic diabetes insipidus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    359 (AQP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    359 (AQP2)
   04147 Exosome [BR:hsa04147]
    359 (AQP2)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    359 (AQP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   359 (AQP2)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 359
NCBI-ProteinID: NP_000477
OMIM: 107777
HGNC: 634
Ensembl: ENSG00000167580
Vega: OTTHUMG00000169709
Pharos: P41181(Tbio)
UniProt: P41181
LinkDB
Structure
PDB: 
4NEF 4OJ2 6QF5

Position
12q13.12
AA seq 271 aa
MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALG
HISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNA
LSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTG
CSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGL
EPDTDWEEREVRRRQSVELHSPQSLPRGTKA
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtgggagctccgctccatagccttctccagggctgtgttcgcagagttcctggccaca
ctcctcttcgtcttctttggcctcggctctgccctcaactggccacaggccctgccctct
gtgctacagattgccatggcgtttggcttgggtattggcaccctggtacaggctctgggc
cacataagcggggcccacatcaaccctgccgtgactgtggcctgcctggtgggctgccac
gtctccgttctccgagccgccttctacgtggctgcccagctgctgggggctgtggccgga
gccgctctgctccatgagatcacgccagcagacatccgcggggacctggctgtcaatgct
ctcagcaacagcacgacggctggccaggcggtgactgtggagctcttcctgacactgcag
ctggtgctctgcatcttcgcctccaccgatgagcgccgcggagagaacccgggcacccct
gctctctccataggcttctctgtggccctgggccacctccttgggatccattacaccggc
tgctctatgaatcctgcccgctccctggctccagctgtcgtcactggcaaatttgatgac
cactgggtcttctggatcggacccctggtgggcgccatcctgggctccctcctctacaac
tacgtgctgtttccgccagccaagagcctgtcggagcgcctggcagtgctgaagggcctg
gagccggacaccgattgggaggagcgcgaggtgcgacggcggcagtcggtggagctgcac
tcgccgcagagcctgccacggggtaccaaggcctga

DBGET integrated database retrieval system