KEGG   Homo sapiens (human): 3796
Entry
3796              CDS       T01001                                 

Gene name
KIF2A, CDCBM3, HK2, KIF2
Definition
(RefSeq) kinesin family member 2A
  KO
K10393  kinesin family member 2/24
Organism
hsa  Homo sapiens (human)
Disease
H01881  Complex cortical dysplasia with other brain malformations
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3796 (KIF2A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3796 (KIF2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     3796 (KIF2A)
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    3796 (KIF2A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3796 (KIF2A)
SSDB
Motif
Pfam: Kinesin Microtub_bd UPF0242
Other DBs
NCBI-GeneID: 3796
NCBI-ProteinID: NP_004511
OMIM: 602591
HGNC: 6318
Ensembl: ENSG00000068796
Vega: OTTHUMG00000097755
Pharos: O00139(Tbio)
UniProt: O00139
LinkDB
Structure
PDB: 
2GRY 6BBN

Position
5q12.1
AA seq 706 aa
MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLESIF
SLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARP
SQFPEQSSSAQQNGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQEL
REKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICVCVRKRPLNKKETQM
KDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVET
IFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKPNYKKLEL
QVYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSC
RTSGQTSANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGADTSSADRQTRLEGAE
INKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENT
LNTLRYANRVKELTVDPTAAGDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNE
EEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALLEMTEEVDYDVDSYA
TQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcaacggccaacttcggcaagatccagatcgggatttacgtggagatcaagcgcagc
gatggccgaatacatcaagcaatggtaacatctttaaatgaagataatgaaagtgtaact
gttgaatggatagaaaatggagatacaaaaggcaaagagattgacctggagagcatcttt
tcacttaaccctgaccttgttcctgatgaagaaattgaacccagtccagaaacacctcca
cctccagcatcctcagccaaagtaaacaaaattgtaaagaatcgacggactgtagcttct
attaagaatgaccctccttcaagagataatagagtggttggttcagcacgtgcacggccc
agtcaatttcctgaacagtcttcctctgcacaacagaatggtagtgtttcagatatatct
ccagttcaagctgcaaaaaaggaatttggacccccttcacgtagaaaatctaattgtgtg
aaagaagtagaaaaactgcaagaaaaacgagagaaaaggagattgcaacagcaagaactt
agagaaaaaagagcccaggacgttgatgctacaaacccaaattatgaaattatgtgtatg
atcagagactttagaggaagtttggattatagaccattaacaacagcagatcctattgat
gaacataggatatgtgtgtgtgtaagaaaacgaccactcaataaaaaagaaactcaaatg
aaagatcttgatgtaatcacaattcctagtaaagatgttgtgatggtacatgaaccaaaa
caaaaagtagatttaacaaggtacctagaaaaccaaacatttcgttttgattatgccttt
gatgactcagctcctaatgaaatggtttacaggtttactgctagaccactagtggaaact
atatttgaaaggggaatggctacatgctttgcttatgggcagactggaagtggaaaaact
catactatgggtggtgacttttcaggaaagaaccaagattgttctaaaggaatttatgca
ttagcagctcgagatgtctttttaatgctaaagaagccaaactataagaagctagaactt
caagtatatgcaaccttctttgaaatttatagtggaaaggtgtttgacttgctaaacagg
aaaacaaaattaagagttctagaagatggaaaacagcaggttcaagtggtgggattacag
gaacgggaggtcaaatgtgttgaagatgtactgaaactcattgacataggcaacagttgc
agaacatccggtcaaacatctgcaaatgcacattcatctcggagccatgcagtgtttcag
attattcttagaaggaaaggaaaactacatggcaaattttctctcattgatttggctgga
aatgaaagaggagctgatacttccagtgcggacaggcaaactaggcttgaaggtgctgaa
attaataaaagccttttagcactcaaggagtgcatcagagccttaggtagaaataaacct
catactcctttccgtgcaagtaaactcactcaggtgttaagagattctttcataggtgaa
aactctcgtacctgcatgattgccacaatctctccaggaatggcatcctgtgaaaatact
cttaatacattaagatatgcaaatagggtcaaagaattgactgtagatccaactgctgct
ggtgatgttcgtccaataatgcaccatccaccaaaccagattgatgacttagagacacag
tggggtgtggggagttcccctcagagagatgatctaaaacttctttgtgaacaaaatgaa
gaagaagtctctccacagttgtttactttccacgaagctgtttcacaaatggtagaaatg
gaagaacaagttgtagaagatcacagggcagtgttccaggaatctattcggtggttagaa
gatgaaaaggccctcttagagatgactgaagaagtagattatgatgtcgattcatatgct
acacaacttgaagctattcttgagcaaaaaatagacattttaactgaactgcgggataaa
gtgaaatctttccgtgcagctctacaagaggaggaacaagccagcaagcaaatcaacccg
aagagaccccgtgccctttaa

DBGET integrated database retrieval system