KEGG   Homo sapiens (human): 4211Help
Entry
4211              CDS       T01001                                 

Gene name
MEIS1
Definition
(RefSeq) Meis homeobox 1
  KO
K15613  homeobox protein Meis1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00120  MLL-ENL fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4211 (MEIS1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4211 (MEIS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4211 (MEIS1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, MEIS
    4211 (MEIS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Meis_PKNOX_N Homeobox_KN Homeodomain
Motif
Other DBs
NCBI-GeneID: 4211
NCBI-ProteinID: NP_002389
OMIM: 601739
HGNC: 7000
Ensembl: ENSG00000143995
Vega: OTTHUMG00000150714
Pharos: O00470(Tbio)
UniProt: O00470
LinkDB All DBs
Structure
PDB: 

Position
2p14
AA seq 390 aa AA seqDB search
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA
PSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNED
IAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGK
MPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHS
GDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP
SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVM
DGQQHMGIRAPGPMSGMGMNMGMEGQWHYM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaggtacgacgatctaccccattacgggggcatggatggagtaggcatcccc
tccacgatgtatggggacccgcatgcagccaggtccatgcagccggtccaccacctgaac
cacgggcctcctctgcactcgcatcagtacccgcacacagctcataccaacgccatggcc
cccagcatgggctcctctgtcaatgacgctttaaagagagataaagatgccatttatgga
caccccctcttccctctcttagcactgatttttgagaaatgtgaattagctacttgtacc
ccccgcgagccgggggtggcgggcggggacgtctgctcgtcagagtcattcaatgaagat
atagccgtgttcgccaaacagattcgcgcagaaaaacctctattttcttctaatccagaa
ctggataacttgatgattcaagccatacaagtattaaggtttcatctattggaattagag
aaggtacacgaattatgtgacaatttctgccaccggtatattagctgtttgaaagggaaa
atgcctatcgatttggtgatagacgatagagaaggaggatcaaaatcagacagtgaagat
ataacaagatcagcaaatctaactgaccagccctcttggaacagagatcatgatgacacg
gcatctactcgttcaggaggaaccccaggcccttccagcggtggccacacgtcacacagt
ggggacaacagcagtgagcaaggtgatggcttggacaacagtgtagcttcccccagcaca
ggtgacgatgatgaccctgataaggacaaaaagcgtcacaaaaagcgtggcatctttccc
aaagtagccacaaatatcatgagggcgtggctgttccagcatctaacacacccttaccct
tctgaagaacagaaaaagcagttggcacaagacacgggactcaccatccttcaagtgaac
aattggtttattaatgcccggagaagaatagtgcagcccatgatagaccagtccaaccga
gcagtaagtcaaggaacaccttataatcctgatggacagcccatgggaggtttcgtaatg
gacggtcagcaacatatgggaattagagcaccaggacctatgagtggaatgggcatgaat
atgggcatggaggggcagtggcactacatgtaa

DBGET integrated database retrieval system