KEGG   Homo sapiens (human): 4297Help
Entry
4297              CDS       T01001                                 

Gene name
KMT2A, ALL-1, CXXC7, HRX, HTRX1, MLL, MLL1, MLL1A, TRX1, WDSTS
Definition
(RefSeq) lysine methyltransferase 2A
  KO
K09186  [histone H3]-lysine4 N-trimethyltransferase MLL1 [EC:2.1.1.354]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa04934  Cushing syndrome
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
nt06360  Cushing syndrome
  Element
N00119  MLL-AF4 fusion to transcriptional activation
N00120  MLL-ENL fusion to transcriptional activation
N00290  Mutation-inactivated MEN1 to transcription
Disease
H00001  B-cell acute lymphoblastic leukemia
H00002  T-cell acute lymphoblastic leukemia
H01879  Wiedemann-Steiner syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    4297 (KMT2A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4297 (KMT2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    4297 (KMT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4297 (KMT2A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4297 (KMT2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     4297 (KMT2A)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    4297 (KMT2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     4297 (KMT2A)
   HMT complexes
    MLL-HCF complex
     4297 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC SET PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 Bromodomain PHD_2 PHD_4
Motif
Other DBs
NCBI-GeneID: 4297
NCBI-ProteinID: NP_005924
OMIM: 159555
HGNC: 7132
Ensembl: ENSG00000118058
Vega: OTTHUMG00000166337
Pharos: Q03164(Tbio)
UniProt: Q03164
LinkDB All DBs
Structure
PDB: 

Position
11q23.3
AA seq 3969 aa AA seqDB search
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAV
AAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSA
AIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKD
ISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIV
RRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSR
IIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSS
SPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPAS
TAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPED
VGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSL
SISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFT
PGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKI
LIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTD
KRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKA
PQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
PSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVP
KTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNIL
STLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNK
CRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCA
KLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYT
CVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESI
PSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINS
DGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDH
NYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPE
LNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKN
VHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDL
IKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDC
EDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPT
SFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCR
PLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYS
RNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHL
DGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTS
RELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVK
TLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNL
KPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTV
KVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSC
QDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSY
GEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASH
NLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPED
AGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNL
LDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEG
LGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPT
VPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMD
ADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQIS
NAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTS
VLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNP
PSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTP
SNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAP
LLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPG
HVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAI
TAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQV
SNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKT
KRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSS
QKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESI
TEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRML
GILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNF
LASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHG
RGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGN
AARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCG
AKKCRKFLN
NT seq 11910 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcgcttccccgcccgacccgggaccaccgggggcggcggc
ggcggggggcgccggggcctagggggcgccccgcggcaacgcgtcccggccctgctgctt
ccccccgggcccccggtcggcggtggcggccccggggcgcccccctcccccccggctgtg
gcggccgcggcggcggcggcgggaagcagcggggctggggttccagggggagcggccgcc
gcctcagcagcctcctcgtcgtccgcctcgtcttcgtcttcgtcatcgtcctcagcctct
tcagggccggccctgctccgggtgggcccgggcttcgacgcggcgctgcaggtctcggcc
gccatcggcaccaacctgcgccggttccgggccgtgtttggggagagcggcgggggaggc
ggcagcggagaggatgagcaattcttaggttttggctcagatgaagaagtcagagtgcga
agtcccacaaggtctccttcagttaaaactagtcctcgaaaacctcgtgggagacctaga
agtggctctgaccgaaattcagctatcctctcagatccatctgtgttttcccctctaaat
aaatcagagaccaaatctggagataagatcaagaagaaagattctaaaagtatagaaaag
aagagaggaagacctcccaccttccctggagtaaaaatcaaaataacacatggaaaggac
atttcagagttaccaaagggaaacaaagaagatagcctgaaaaaaattaaaaggacacct
tctgctacgtttcagcaagccacaaagattaaaaaattaagagcaggtaaactctctcct
ctcaagtctaagtttaagacagggaagcttcaaataggaaggaagggggtacaaattgta
cgacggagaggaaggcctccatcaacagaaaggataaagaccccttcgggtctcctcatt
aattctgaactggaaaagccccagaaagtccggaaagacaaggaaggaacacctccactt
acaaaagaagataagacagttgtcagacaaagccctcgaaggattaagccagttaggatt
attccttcttcaaaaaggacagatgcaaccattgctaagcaactcttacagagggcaaaa
aagggggctcaaaagaaaattgaaaaagaagcagctcagctgcagggaagaaaggtgaag
acacaggtcaaaaatattcgacagttcatcatgcctgttgtcagtgctatctcctcgcgg
atcattaagacccctcggcggtttatagaggatgaggattatgaccctccaattaaaatt
gcccgattagagtctacaccgaatagtagattcagtgccccgtcctgtggatcttctgaa
aaatcaagtgcagcttctcagcactcctctcaaatgtcttcagactcctctcgatctagt
agccccagtgttgatacctccacagactctcaggcttctgaggagattcaggtacttcct
gaggagcggagcgatacccctgaagttcatcctccactgcccatttcccagtccccagaa
aatgagagtaatgataggagaagcagaaggtattcagtgtcggagagaagttttggatct
agaacgacgaaaaaattatcaactctacaaagtgccccccagcagcagacctcctcgtct
ccacctccacctctgctgactccaccgccaccactgcagccagcctccagtatctctgac
cacacaccttggcttatgcctccaacaatccccttagcatcaccatttttgcctgcttcc
actgctcctatgcaagggaagcgaaaatctattttgcgagaaccgacatttaggtggact
tctttaaagcattctaggtcagagccacaatacttttcctcagcaaagtatgccaaagaa
ggtcttattcgcaaaccaatatttgataatttccgaccccctccactaactcccgaggac
gttggctttgcatctggtttttctgcatctggtaccgctgcttcagcccgattgttttcg
ccactccattctggaacaaggtttgatatgcacaaaaggagccctcttctgagagctcca
agatttactccaagtgaggctcactctagaatatttgagtctgtaaccttgcctagtaat
cgaacttctgctggaacatcttcttcaggagtatccaatagaaaaaggaaaagaaaagtg
tttagtcctattcgatctgaaccaagatctccttctcactccatgaggacaagaagtgga
aggcttagtagttctgagctctcacctctcacccccccgtcttctgtctcttcctcgtta
agcatttctgttagtcctcttgccactagtgccttaaacccaacttttacttttccttct
cattccctgactcagtctggggaatctgcagagaaaaatcagagaccaaggaagcagact
agtgctccggcagagccattttcatcaagtagtcctactcctctcttcccttggtttacc
ccaggctctcagactgaaagagggagaaataaagacaaggcccccgaggagctgtccaaa
gatcgagatgctgacaagagcgtggagaaggacaagagtagagagagagaccgggagaga
gaaaaggagaataagcgggagtcaaggaaagagaaaaggaaaaagggatcagaaattcag
agtagttctgctttgtatcctgtgggtagggtttccaaagagaaggttgttggtgaagat
gttgccacttcatcttctgccaaaaaagcaacagggcggaagaagtcttcatcacatgat
tctgggactgatattacttctgtgactcttggggatacaacagctgtcaaaaccaaaata
cttataaagaaagggagaggaaatctggaaaaaaccaacttggacctcggcccaactgcc
ccatccctggagaaggagaaaaccctctgcctttccactccttcatctagcactgttaaa
cattccacttcctccataggctccatgttggctcaggcagacaagcttccaatgactgac
aagagggttgccagcctcctaaaaaaggccaaagctcagctctgcaagattgagaagagt
aagagtcttaaacaaaccgaccagcccaaagcacagggtcaagaaagtgactcatcagag
acctctgtgcgaggaccccggattaaacatgtctgcagaagagcagctgttgcccttggc
cgaaaacgagctgtgtttcctgatgacatgcccaccctgagtgccttaccatgggaagaa
cgagaaaagattttgtcttccatggggaatgatgacaagtcatcaattgctggctcagaa
gatgctgaacctcttgctccacccatcaaaccaattaaacctgtcactagaaacaaggca
ccccaggaacctccagtaaagaaaggacgtcgatcgaggcggtgtgggcagtgtcccggc
tgccaggtgcctgaggactgtggtgtttgtactaattgcttagataagcccaagtttggt
ggtcgcaatataaagaagcagtgctgcaagatgagaaaatgtcagaatctacaatggatg
ccttccaaagcctacctgcagaagcaagctaaagctgtgaaaaagaaagagaaaaagtct
aagaccagtgaaaagaaagacagcaaagagagcagtgttgtgaagaacgtggtggactct
agtcagaaacctaccccatcagcaagagaggatcctgccccaaagaaaagcagtagtgag
cctcctccacgaaagcccgtcgaggaaaagagtgaagaagggaatgtctcggcccctggg
cctgaatccaaacaggccaccactccagcttccaggaagtcaagcaagcaggtctcccag
ccagcactggtcatcccgcctcagccacctactacaggaccgccaagaaaagaagttccc
aaaaccactcctagtgagcccaagaaaaagcagcctccaccaccagaatcaggtccagag
cagagcaaacagaaaaaagtggctccccgcccaagtatccctgtaaaacaaaaaccaaaa
gaaaaggaaaaaccacctccggtcaataagcaggagaatgcaggcactttgaacatcctc
agcactctctccaatggcaatagttctaagcaaaaaattccagcagatggagtccacagg
atcagagtggactttaaggaggattgtgaagcagaaaatgtgtgggagatgggaggctta
ggaatcttgacttctgttcctataacacccagggtggtttgctttctctgtgccagtagt
gggcatgtagagtttgtgtattgccaagtctgttgtgagcccttccacaagttttgttta
gaggagaacgagcgccctctggaggaccagctggaaaattggtgttgtcgtcgttgcaaa
ttctgtcacgtttgtggaaggcaacatcaggctacaaagcagctgctggagtgtaataag
tgccgaaacagctatcaccctgagtgcctgggaccaaactaccccaccaaacccacaaag
aagaagaaagtctggatctgtaccaagtgtgttcgctgtaagagctgtggatccacaact
ccaggcaaagggtgggatgcacagtggtctcatgatttctcactgtgtcatgattgcgcc
aagctctttgctaaaggaaacttctgccctctctgtgacaaatgttatgatgatgatgac
tatgagagtaagatgatgcaatgtggaaagtgtgatcgctgggtccattccaaatgtgag
aatctttcagatgagatgtatgagattctatctaatctgccagaaagtgtggcctacact
tgtgtgaactgtactgagcggcaccctgcagagtggcgactggcccttgaaaaagagctg
cagatttctctgaagcaagttctgacagctttgttgaattctcggactaccagccatttg
ctacgctaccggcaggctgccaagcctccagacttaaatcccgagacagaggagagtata
ccttcccgcagctcccccgaaggacctgatccaccagttcttactgaggtcagcaaacag
gatgatcagcagcctttagatctagaaggagtcaagaggaagatggaccaagggaattac
acatctgtgttggagttcagtgatgatattgtgaagatcattcaagcagccattaattca
gatggaggacagccagaaattaaaaaagccaacagcatggtcaagtccttcttcattcgg
caaatggaacgtgtttttccatggttcagtgtcaaaaagtccaggttttgggagccaaat
aaagtatcaagcaacagtgggatgttaccaaacgcagtgcttccaccttcacttgaccat
aattatgctcagtggcaggagcgagaggaaaacagccacactgagcagcctcctttaatg
aagaaaatcattccagctcccaaacccaaaggtcctggagaaccagactcaccaactcct
ctgcatcctcctacaccaccaattttgagtactgataggagtcgagaagacagtccagag
ctgaacccacccccaggcatagaagacaatagacagtgtgcgttatgtttgacttatggt
gatgacagtgctaatgatgctggtcgtttactatatattggccaaaatgagtggacacat
gtaaattgtgctttgtggtcagcggaagtgtttgaagatgatgacggatcactaaagaat
gtgcatatggctgtgatcaggggcaagcagctgagatgtgaattctgccaaaagccagga
gccaccgtgggttgctgtctcacatcctgcaccagcaactatcacttcatgtgttcccga
gccaagaactgtgtctttctggatgataaaaaagtatattgccaacgacatcgggatttg
atcaaaggcgaagtggttcctgagaatggatttgaagttttcagaagagtgtttgtggac
tttgaaggaatcagcttgagaaggaagtttctcaatggcttggaaccagaaaatatccac
atgatgattgggtctatgacaatcgactgcttaggaattctaaatgatctctccgactgt
gaagataagctctttcctattggatatcagtgttccagggtatactggagcaccacagat
gctcgcaagcgctgtgtatatacatgcaagatagtggagtgccgtcctccagtcgtagag
ccggatatcaacagcactgttgaacatgatgaaaacaggaccattgcccatagtccaaca
tcttttacagaaagttcatcaaaagagagtcaaaacacagctgaaattataagtcctcca
tcaccagaccgacctcctcattcacaaacctctggctcctgttattatcatgtcatctca
aaggtccccaggattcgaacacccagttattctccaacacagagatcccctggctgtcga
ccgttgccttctgcaggaagtcctaccccaaccactcatgaaatagtcacagtaggtgat
cctttactctcctctggacttcgaagcattggctccaggcgtcacagtacctcttcctta
tcaccccagcggtccaaactccggataatgtctccaatgagaactgggaatacttactct
aggaataatgtttcctcagtctccaccaccgggaccgctactgatcttgaatcaagtgcc
aaagtagttgatcatgtcttagggccactgaattcaagtactagtttagggcaaaacact
tccacctcttcaaatttgcaaaggacagtggttactgtaggcaataaaaacagtcacttg
gatggatcttcatcttcagaaatgaagcagtccagtgcttcagacttggtgtccaagagc
tcctctttaaagggagagaagaccaaagtgctgagttccaagagctcagagggatctgca
cataatgtggcttaccctggaattcctaaactggccccacaggttcataacacaacatct
agagaactgaatgttagtaaaatcggctcctttgctgaaccctcttcagtgtcgttttct
tctaaagaggccctctccttcccacacctccatttgagagggcaaaggaatgatcgagac
caacacacagattctacccaatcagcaaactcctctccagatgaagatactgaagtcaaa
accttgaagctatctggaatgagcaacagatcatccattatcaacgaacatatgggatct
agttccagagataggagacagaaagggaaaaaatcctgtaaagaaactttcaaagaaaag
cattccagtaaatcttttttggaacctggtcaggtgacaactggtgaggaaggaaacttg
aagccagagtttatggatgaggttttgactcctgagtatatgggccaacgaccatgtaac
aatgtttcttctgataagattggtgataaaggcctttctatgccaggagtccccaaagct
ccacccatgcaagtagaaggatctgccaaggaattacaggcaccacggaaacgcacagtc
aaagtgacactgacacctctaaaaatggaaaatgagagtcaatccaaaaatgccctgaaa
gaaagtagtcctgcttcccctttgcaaatagagtcaacatctcccacagaaccaatttca
gcctctgaaaatccaggagatggtccagtggcccaaccaagccccaataatacctcatgc
caggattctcaaagtaacaactatcagaatcttccagtacaggacagaaacctaatgctt
ccagatggccccaaacctcaggaggatggctcttttaaaaggaggtatccccgtcgcagt
gcccgtgcacgttctaacatgttttttgggcttaccccactctatggagtaagatcctat
ggtgaagaagacattccattctacagcagctcaactgggaagaagcgaggcaagagatca
gctgaaggacaggtggatggggccgatgacttaagcacttcagatgaagacgacttatac
tattacaacttcactagaacagtgatttcttcaggtggagaggaacgactggcatcccat
aatttatttcgggaggaggaacagtgtgatcttccaaaaatctcacagttggatggtgtt
gatgatgggacagagagtgatactagtgtcacagccacaacaaggaaaagcagccagatt
ccaaaaagaaatggtaaagaaaatggaacagagaacttaaagattgatagacctgaagat
gctggggagaaagaacatgtcactaagagttctgttggccacaaaaatgagccaaagatg
gataactgccattctgtaagcagagttaaaacacagggacaagattccttggaagctcag
ctcagctcattggagtcaagccgcagagtccacacaagtaccccctccgacaaaaattta
ctggacacctataatactgagctcctgaaatcagattcagacaataacaacagtgatgac
tgtgggaatatcctgccttcagacattatggactttgtactaaagaatactccatccatg
caggctttgggtgagagcccagagtcatcttcatcagaactcctgaatcttggtgaagga
ttgggtcttgacagtaatcgtgaaaaagacatgggtctttttgaagtattttctcagcag
ctgcctacaacagaacctgtggatagtagtgtctcttcctctatctcagcagaggaacag
tttgagttgcctctagagctaccatctgatctgtctgtcttgaccacccggagtcccact
gtccccagccagaatcccagtagactagctgttatctcagactcaggggagaagagagta
accatcacagaaaaatctgtagcctcctctgaaagtgacccagcactgctgagcccagga
gtagatccaactcctgaaggccacatgactcctgatcattttatccaaggacacatggat
gcagaccacatctctagccctccttgtggttcagtagagcaaggtcatggcaacaatcag
gatttaactaggaacagtagcacccctggccttcaggtacctgtttccccaactgttccc
atccagaaccagaagtatgtgcccaattctactgatagtcctggcccgtctcagatttcc
aatgcagctgtccagaccactccaccccacctgaagccagccactgagaaactcatagtt
gttaaccagaacatgcagccactttatgttctccaaactcttccaaatggagtgacccaa
aaaatccaattgacctcttctgttagttctacacccagtgtgatggagacaaatacttca
gtattgggacccatgggaggtggtctcacccttaccacaggactaaatccaagcttgcca
acttctcaatctttgttcccttctgctagcaaaggattgctacccatgtctcatcaccag
cacttacattccttccctgcagctactcaaagtagtttcccaccaaacatcagcaatcct
ccttcaggcctgcttattggggttcagcctcctccggatccccaacttttggtttcagaa
tccagccagaggacagacctcagtaccacagtagccactccatcctctggactcaagaaa
agacccatatctcgtctacagacccgaaagaataaaaaacttgctccctctagtacccct
tcaaacattgccccttctgatgtggtttctaatatgacattgattaacttcacaccctcc
cagcttcctaatcatccaagtctgttagatttggggtcacttaatacttcatctcaccga
actgtccccaacatcataaaaagatctaaatctagcatcatgtattttgaaccggcaccc
ctgttaccacagagtgtgggaggaactgctgccacagcggcaggcacatcaacaataagc
caggatactagccacctcacatcagggtctgtgtctggcttggcatccagttcctctgtc
ttgaatgttgtatccatgcaaactaccacaacccctacaagtagtgcgtcagttccagga
cacgtcaccttaaccaacccaaggttgcttggtaccccagatattggctcaataagcaat
cttttaatcaaagctagccagcagagcctggggattcaggaccagcctgtggctttaccg
ccaagttcaggaatgtttccacaactggggacatcacagaccccctctactgctgcaata
acagcggcatctagcatctgtgtgctcccctccactcagactacgggcataacagccgct
tcaccttctggggaagcagacgaacactatcagcttcagcatgtgaaccagctccttgcc
agcaaaactgggattcattcttcccagcgtgatcttgattctgcttcagggccccaggta
tccaactttacccagacggtagacgctcctaatagcatgggactggagcagaacaaggct
ttatcctcagctgtgcaagccagccccacctctcctgggggttctccatcctctccatct
tctggacagcggtcagcaagcccttcagtgccgggtcccactaaacccaaaccaaaaacc
aaacggtttcagctgcctctagacaaagggaatggcaagaagcacaaagtttcccatttg
cggaccagttcttctgaagcacacattccagaccaagaaacgacatccctgacctcaggc
acagggactccaggagcagaggctgagcagcaggatacagctagcgtggagcagtcctcc
cagaaggagtgtgggcaacctgcagggcaagtcgctgttcttccggaagttcaggtgacc
caaaatccagcaaatgaacaagaaagtgcagaacctaaaacagtggaagaagaggaaagt
aatttcagctccccactgatgctttggcttcagcaagaacaaaagcggaaggaaagcatt
actgagaaaaaacccaagaaaggacttgtttttgaaatttccagtgatgatggctttcag
atctgtgcagaaagtattgaagatgcctggaagtcattgacagataaagtccaggaagct
cgatcaaatgcccgcctaaagcagctctcatttgcaggtgttaacggtttgaggatgctg
gggattctccatgatgcagttgtgttcctcattgagcagctgtctggtgccaagcactgt
cgaaattacaaattccgtttccacaagccagaggaggccaatgaaccccccttgaaccct
cacggctcagccagggctgaagtccacctcaggaagtcagcatttgacatgtttaacttc
ctggcttctaaacatcgtcagcctcctgaatacaaccccaatgatgaagaagaggaggag
gtacagctgaagtcagctcggagggcaactagcatggatctgccaatgcccatgcgcttc
cggcacttaaaaaagacttctaaggaggcagttggtgtctacaggtctcccatccatggc
cggggtcttttctgtaagagaaacattgatgcaggtgagatggtgattgagtatgccggc
aacgtcatccgctccatccagactgacaagcgggaaaagtattacgacagcaagggcatt
ggttgctatatgttccgaattgatgactcagaggtagtggatgccaccatgcatggaaat
gctgcacgcttcatcaatcactcgtgtgagcctaactgctattctcgggtcatcaatatt
gatgggcagaagcacattgtcatctttgccatgcgtaagatctaccgaggagaggaactc
acttacgactataagttccccattgaggatgccagcaacaagctgccctgcaactgtggc
gccaagaaatgccggaagttcctaaactaa

DBGET integrated database retrieval system