KEGG   Homo sapiens (human): 4824Help
Entry
4824              CDS       T01001                                 

Gene name
NKX3-1, BAPX2, NKX3, NKX3.1, NKX3A
Definition
(RefSeq) NK3 homeobox 1
  KO
K09348  homeobox protein Nkx-3.1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
Network
nt06214  PI3K signaling
nt06272  Prostate cancer
  Element
N00082  Loss of NKX3-1 to PI3K signaling pathway
Disease
H00024  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4824 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    4824 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4824 (NKX3-1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    4824 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Trypan_PARP Homeobox_KN Homez
Motif
Other DBs
NCBI-GeneID: 4824
NCBI-ProteinID: NP_006158
OMIM: 602041
HGNC: 7838
Ensembl: ENSG00000167034
Vega: OTTHUMG00000097851
Pharos: Q99801(Tbio)
UniProt: Q99801
LinkDB All DBs
Structure
PDB: 

Position
8p21.2
AA seq 234 aa AA seqDB search
MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP
EPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTP
KQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTK
RKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgctcagggttccggagccgcggcccggggaggcgaaagcggagggggccgcgccgccg
accccgtccaagccgctcacgtccttcctcatccaggacatcctgcgggacggcgcgcag
cggcaaggcggccgcacgagcagccagagacagcgcgacccggagccggagccagagcca
gagccagagggaggacgcagccgcgccggggcgcagaacgaccagctgagcaccgggccc
cgcgccgcgccggaggaggccgagacgctggcagagaccgagccagaaaggcacttgggg
tcttatctgttggactctgaaaacacttcaggcgcccttccaaggcttccccaaacccct
aagcagccgcagaagcgctcccgagctgccttctcccacactcaggtgatcgagttggag
aggaagttcagccatcagaagtacctgtcggcccctgaacgggcccacctggccaagaac
ctcaagctcacggagacccaagtgaagatatggttccagaacagacgctataagactaag
cgaaagcagctctcctcggagctgggagacttggagaagcactcctctttgccggccctg
aaagaggaggccttctcccgggcctccctggtctccgtgtataacagctatccttactac
ccatacctgtactgcgtgggcagctggagcccagctttttggtaa

DBGET integrated database retrieval system