KEGG   Homo sapiens (human): 4878Help
Entry
4878              CDS       T01001                                 

Gene name
NPPA, ANF, ANP, ATFB6, ATRST2, CDD, CDD-ANF, CDP, PND
Definition
(RefSeq) natriuretic peptide A
  KO
K12334  natriuretic peptide A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04714  Thermogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa05143  African trypanosomiasis
Disease
H00731  Atrial fibrillation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    4878 (NPPA)
   04024 cAMP signaling pathway
    4878 (NPPA)
   04022 cGMP-PKG signaling pathway
    4878 (NPPA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    4878 (NPPA)
   04921 Oxytocin signaling pathway
    4878 (NPPA)
   04924 Renin secretion
    4878 (NPPA)
   04925 Aldosterone synthesis and secretion
    4878 (NPPA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4878 (NPPA)
  09159 Environmental adaptation
   04714 Thermogenesis
    4878 (NPPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    4878 (NPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANP
Motif
Other DBs
NCBI-GeneID: 4878
NCBI-ProteinID: NP_006163
OMIM: 108780
HGNC: 7939
Ensembl: ENSG00000175206
Vega: OTTHUMG00000002388
Pharos: P01160(Tchem)
CPD: C16003
UniProt: P01160
LinkDB All DBs
Structure
PDB: 

Position
1p36.22
AA seq 151 aa AA seqDB search
MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagctccttctccaccaccaccgtgagcttcctccttttactggcattccagctccta
ggtcagaccagagctaatcccatgtacaatgccgtgtccaacgcagacctgatggatttc
aagaatttgctggaccatttggaagaaaagatgcctttagaagatgaggtcgtgccccca
caagtgctcagtgagccgaatgaagaagcgggggctgctctcagccccctccctgaggtg
cctccctggaccggggaagtcagcccagcccagagagatggaggtgccctcgggcggggc
ccctgggactcctctgatcgatctgccctcctaaaaagcaagctgagggcgctgctcact
gcccctcggagcctgcggagatccagctgcttcgggggcaggatggacaggattggagcc
cagagcggactgggctgtaacagcttccggtactga

DBGET integrated database retrieval system