KEGG   Homo sapiens (human): 4982Help
Entry
4982              CDS       T01001                                 

Gene name
TNFRSF11B, OCIF, OPG, PDB5, TR1
Definition
(RefSeq) TNF receptor superfamily member 11b
  KO
K05148  tumor necrosis factor receptor superfamily member 11B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04380  Osteoclast differentiation
Disease
H00437  Paget disease of bone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4982 (TNFRSF11B)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    4982 (TNFRSF11B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    4982 (TNFRSF11B)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   4982 (TNFRSF11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death EcoEI_R_C
Motif
Other DBs
NCBI-GeneID: 4982
NCBI-ProteinID: NP_002537
OMIM: 602643
HGNC: 11909
Ensembl: ENSG00000164761
Vega: OTTHUMG00000164969
Pharos: O00300(Tbio)
UniProt: O00300
LinkDB All DBs
Structure
PDB: 

Position
8q24.12
AA seq 401 aa AA seqDB search
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT
VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK
HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT
HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT
VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacttgctgtgctgcgcgctcgtgtttctggacatctccattaagtggaccacc
caggaaacgtttcctccaaagtaccttcattatgacgaagaaacctctcatcagctgttg
tgtgacaaatgtcctcctggtacctacctaaaacaacactgtacagcaaagtggaagacc
gtgtgcgccccttgccctgaccactactacacagacagctggcacaccagtgacgagtgt
ctatactgcagccccgtgtgcaaggagctgcagtacgtcaagcaggagtgcaatcgcacc
cacaaccgcgtgtgcgaatgcaaggaagggcgctaccttgagatagagttctgcttgaaa
cataggagctgccctcctggatttggagtggtgcaagctggaaccccagagcgaaataca
gtttgcaaaagatgtccagatgggttcttctcaaatgagacgtcatctaaagcaccctgt
agaaaacacacaaattgcagtgtctttggtctcctgctaactcagaaaggaaatgcaaca
cacgacaacatatgttccggaaacagtgaatcaactcaaaaatgtggaatagatgttacc
ctgtgtgaggaggcattcttcaggtttgctgttcctacaaagtttacgcctaactggctt
agtgtcttggtagacaatttgcctggcaccaaagtaaacgcagagagtgtagagaggata
aaacggcaacacagctcacaagaacagactttccagctgctgaagttatggaaacatcaa
aacaaagaccaagatatagtcaagaagatcatccaagatattgacctctgtgaaaacagc
gtgcagcggcacattggacatgctaacctcaccttcgagcagcttcgtagcttgatggaa
agcttaccgggaaagaaagtgggagcagaagacattgaaaaaacaataaaggcatgcaaa
cccagtgaccagatcctgaagctgctcagtttgtggcgaataaaaaatggcgaccaagac
accttgaagggcctaatgcacgcactaaagcactcaaagacgtaccactttcccaaaact
gtcactcagagtctaaagaagaccatcaggttccttcacagcttcacaatgtacaaattg
tatcagaagttatttttagaaatgataggtaaccaggtccaatcagtaaaaataagctgc
ttataa

DBGET integrated database retrieval system