KEGG   Homo sapiens (human): 5228
Entry
5228              CDS       T01001                                 

Gene name
PGF, D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760
Definition
(RefSeq) placental growth factor
  KO
K16859  placenta growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa05200  Pathways in cancer
Drug target
Aflibercept: D09574<JP/US>
Aflibercept beta: D10819<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5228 (PGF)
   04014 Ras signaling pathway
    5228 (PGF)
   04015 Rap1 signaling pathway
    5228 (PGF)
   04151 PI3K-Akt signaling pathway
    5228 (PGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5228 (PGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5228 (PGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5228 (PGF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   5228 (PGF)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 5228
NCBI-ProteinID: NP_002623
OMIM: 601121
HGNC: 8893
Ensembl: ENSG00000119630
Vega: OTTHUMG00000171496
Pharos: P49763(Tclin)
UniProt: P49763 Q53XY6 Q86TW6
LinkDB
Structure
PDB: 
1FZV 1RV6

Position
14q24.3
AA seq 170 aa
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
TFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
NT seq 513 nt   +upstreamnt  +downstreamnt
atgccggtcatgaggctgttcccttgcttcctgcagctcctggccgggctggcgctgcct
gctgtgcccccccagcagtgggccttgtctgctgggaacggctcgtcagaggtggaagtg
gtacccttccaggaagtgtggggccgcagctactgccgggcgctggagaggctggtggac
gtcgtgtccgagtaccccagcgaggtggagcacatgttcagcccatcctgtgtctccctg
ctgcgctgcaccggctgctgcggcgatgagaatctgcactgtgtgccggtggagacggcc
aatgtcaccatgcagctcctaaagatccgttctggggaccggccctcctacgtggagctg
acgttctctcagcacgttcgctgcgaatgccggcctctgcgggagaagatgaagccggaa
aggaggagacccaagggcagggggaagaggaggagagagaagcagagacccacagactgc
cacctgtgcggcgatgctgttccccggaggtaa

DBGET integrated database retrieval system