KEGG   Homo sapiens (human): 5429Help
Entry
5429              CDS       T01001                                 

Gene name
POLH, RAD30, RAD30A, XP-V, XPV
Definition
(RefSeq) DNA polymerase eta
  KO
K03509  DNA polymerase eta [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03460  Fanconi anemia pathway
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum (XP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    5429 (POLH)
 Human Diseases
  Drug resistance
   01524 Platinum drug resistance
    5429 (POLH)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     5429 (POLH)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    5429 (POLH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS IMS_C IMS_HHH PRP21_like_P
Motif
Other DBs
NCBI-GeneID: 5429
NCBI-ProteinID: NP_006493
OMIM: 603968
HGNC: 9181
Ensembl: ENSG00000170734
Vega: OTTHUMG00000014743
Pharos: Q9Y253(Tbio)
UniProt: Q9Y253 A0A024RD62
LinkDB All DBs
Structure
PDB: 

Position
6p21.1
AA seq 713 aa AA seqDB search
MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVT
RSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVD
LTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQI
DNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYA
MCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDND
RVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSPPLT
MLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSL
ESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLK
QKQLNNSSVSSPQQNPWSNCKALPNSLPTEYPGCVPVCEGVSKLEESSKATPAEMDLAHN
SQSMHASSASKSVLEVTQKATPNPSLLAAEDQVPCEKCGSLVPVWDMPEHMDYHFALELQ
KSFLQPHSSNPQVVSAVSHQGKRNPKSPLACTNKRPRPEGMQTLESFFKPLTH
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggctactggacaggatcgagtggttgctctcgtggacatggactgtttttttgttcaa
gtggagcagcggcaaaatcctcatttgaggaataaaccttgtgcagttgtacagtacaaa
tcatggaagggtggtggaataattgcagtgagttatgaagctcgtgcatttggagtcact
agaagtatgtgggcagatgatgctaagaagttatgtccagatcttctactggcacaagtt
cgtgagtcccgtgggaaagctaacctcaccaagtaccgggaagccagtgttgaagtgatg
gagataatgtctcgttttgctgtgattgaacgtgccagcattgatgaggcttacgtagat
ctgaccagtgctgtacaagagagactacaaaagctacaaggtcagcctatctcggcagac
ttgttgccaagcacttacattgaagggttgccccaaggccctacaacggcagaagagact
gttcagaaagaggggatgcgaaaacaaggcttatttcaatggctcgattctcttcagatt
gataacctcacctctccagacctgcagctcaccgtgggagcagtgattgtggaggaaatg
agagcagccatagagagggagactggttttcagtgttcagctggaatttcacacaataag
gtcctggcaaaactggcctgtggactaaacaagcccaaccgccaaaccctggtttcacat
gggtcagtcccacagctcttcagccaaatgcccattcgcaaaatccgtagtcttggagga
aagctaggggcctctgtcattgagatcctagggatagaatacatgggtgaactgacccag
ttcactgaatcccagctccagagtcattttggggagaagaatgggtcttggctatatgcc
atgtgccgagggattgaacatgatccagttaaacccaggcaactacccaaaaccattggc
tgtagtaagaacttcccaggaaaaacagctcttgctactcgggaacaggtacaatggtgg
ctgttgcaattagcccaggaactagaggagagactgactaaagaccgaaatgataatgac
agggtagccacccagctggttgtgagcattcgtgtacaaggagacaaacgcctcagcagc
ctgcgccgctgctgtgcccttacccgctatgatgctcacaagatgagccatgatgcattt
actgtcatcaagaactgtaatacttctggaatccagacagaatggtctcctcctctcaca
atgcttttcctctgtgctacaaaattttctgcctctgccccttcatcttctacagacatc
accagcttcttgagcagtgacccaagttctctgccaaaggtgccagttaccagctcagaa
gctaagacccagggaagtggcccagcggtgacagccactaagaaagcaaccacgtctctg
gaatcattcttccaaaaagctgcagaaaggcagaaagttaaagaagcttcgctttcatct
cttactgctcccactcaggctcccatgagcaattcaccatccaagccctcattacctttt
caaaccagtcaaagtacaggaactgagcccttctttaagcagaaaagtctgcttctaaag
cagaaacagcttaataattcttcagtttcttccccccaacaaaacccatggtccaactgt
aaagcattaccaaactctttaccaacagagtatccagggtgtgtccctgtttgtgaaggg
gtgtcgaagctagaagaatcctctaaagcaactcctgcagagatggatttggcccacaac
agccaaagcatgcacgcctcttcagcttccaaatctgtgctggaggtgactcagaaagca
accccaaatccaagtcttctagctgctgaggaccaagtgccctgtgagaagtgtggctcc
ctggtaccggtatgggatatgccagaacacatggactatcattttgcattggagttgcag
aaatcctttttgcagccccactcttcaaacccccaggttgtttctgccgtatctcatcaa
ggcaaaagaaatcccaagagccctttggcctgcactaataaacgccccaggcctgagggc
atgcaaacattggaatcattttttaagccattaacacattag

DBGET integrated database retrieval system