KEGG   Homo sapiens (human): 54880
Entry
54880             CDS       T01001                                 

Gene name
BCOR, ANOP2, MAA2, MCOPS2
Definition
(RefSeq) BCL6 corepressor
  KO
K23215  bcl-6 corepressor
Organism
hsa  Homo sapiens (human)
Disease
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54880 (BCOR)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     54880 (BCOR)
SSDB
Motif
Pfam: BCOR PUFD Ank_2 Ank_3 Ank_5 Ank_4 Ank
Other DBs
NCBI-GeneID: 54880
NCBI-ProteinID: NP_001116857
OMIM: 300485
HGNC: 20893
Ensembl: ENSG00000183337
Vega: OTTHUMG00000024100
Pharos: Q6W2J9(Tbio)
UniProt: Q6W2J9
LinkDB
Structure
PDB: 
4HPL 6B7G 2N1L

Position
Xp11.4
AA seq 1755 aa
MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDAST
AHRIDGLAALSMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNP
EMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLN
INGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTN
GERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVD
SHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPAADTYSEFHKH
YARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKD
GSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGS
EIPKETLSPPGNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQR
SSSCPRMGGTDAVITNVSGSVSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQ
PPATPAKHSSSTSSKGAKASNPEPSFKANENGLPPSSIFLSPNEAFRSPPIPYPRSYLPY
PAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLPTGRPEFVTYQDAL
GLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILETSSTKLHPDVP
TDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKP
SVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPF
LEPPLGSDGPAVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPS
KLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAM
MRFSELEMKEREGGHPATKDSEMCKFSPADWERLKGNQDKKPKSVTLEEAIAEQNESERC
EYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQVASDMPHSPTLRVDRKRKVSG
DSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIEL
TGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRK
RAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAK
QQKIKENQKTDVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLT
GEYYVENADGKVTVRRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSP
QETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCA
LHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLAT
YSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANP
PGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIF
RCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSS
VEWLHPSDLASDNYW
NT seq 5268 nt   +upstreamnt  +downstreamnt
atgctctcagcaacccccctgtatgggaacgttcacagctggatgaacagcgagagggtc
cgcatgtgtggggcgagcgaagacaggaaaatccttgtaaatgatggtgacgcttcaaaa
gccagactggaactgagggaagagaatcccttgaaccacaacgtggtggatgcgagcacg
gcccataggatcgatggcctggcagcactgagcatggaccgcactggcctgatccgggaa
gggctgcgggtcccgggaaacatcgtctattctagcttgtgtggactgggctcagagaaa
ggtcgggaggctgccacaagcactctaggtggccttgggttttcttcggaaagaaatcca
gagatgcagttcaaaccgaatacacccgagacagtggaggcttctgccgtctctggaaaa
cccccaaatggcttcagtgctatatacaaaacaccgcctggaatacaaaaaagtgctgta
gccacagcagaagcgctgggcttggacaggcctgccagcgacaaacagagccctctcaac
atcaatggtgctagttatctgcggctgccctgggtcaatccttacatggagggtgccacg
ccagccatctaccctttcctcgactcgccaaataagtattcactgaacatgtacaaggcc
ttgctacctcagcagtcctacagcttggcccagccgctgtattctccagtctgcaccaat
ggggagcgctttctctacctgccgccacctcactacgtcggtccccacatcccatcgtcc
ttggcatcacccatgaggctctcgacaccttcggcctccccagccatcccgcctctcgtc
cattgcgcagacaaaagcctcccgtggaagatgggcgtcagccctgggaatcctgttgat
tcccacgcctatcctcacatccagaacagtaagcagcccagggttccctctgccaaggcg
gtcaccagtggcctgccgggggacacagctctcctgttgcccccctcgcctcggccgtca
ccccgagtccaccttcccacccagcctgctgcagacacctactcggagttccacaagcac
tatgccaggatctccacctctccttcagttgccctgtcaaagccatacatgacagttagc
agcgagttccccgcggccaggctctccaatggcaagtatcccaaggctccggaagggggc
gaaggtgcccagccagtgcccgggcatgcccggaagacagcggttcaagacagaaaagat
ggcagctcacctcctctgttggagaagcagaccgttaccaaagacgtcacagataagcca
ctagacttgtcttctaaagtggtggatgtagatgcttccaaagctgaccacatgaaaaag
atggctcccacggtcctggttcacagcagggctggaagtggcttagtgctctccggaagt
gagattccgaaagaaacactatctcctccaggaaatggttgtgctatctatagatctgaa
atcatcagcactgctccctcatcctgggtggtgcccgggccaagtcctaacgaagagaac
aatggcaaaagcatgtcgctgaaaaacaaggcattggactgggcgataccacagcagcgg
agttcatcatgcccgcgcatgggcggcaccgatgctgtcatcactaacgtttcagggtca
gtgtcgagtgcaggccgcccagcctccgcatcacccgcccccaatgccaatgcagatggc
accaaaaccagcaggagctctgtagaaaccacaccatccgttattcagcacgtgggccag
cccccggccactcctgccaagcacagtagcagcaccagcagcaagggcgccaaagccagc
aacccagaaccgagtttcaaagcaaacgagaacggccttccaccaagctctatatttctg
tctccaaatgaggcattcaggtccccaccaattccctaccccaggagttacctcccttac
ccagcccctgagggcattgctgtaagtcccctctccttacatggcaaaggacctgtctac
cctcacccagttttgttacccaatggcagtctgtttcctgggcaccttgccccaaagcct
gggctgccctatgggcttcccaccggccgtccagagtttgtgacctaccaagatgccctg
gggttgggcatggtgcatcccatgttgataccacacacgcccatagagattactaaagag
gagaaaccagagaggagatcccggtcccatgagagagcccgttacgaggacccaaccctc
cggaatcggttttccgagattttggaaactagcagcaccaagttacatccagatgtcccc
accgacaagaacctaaagccgaaccccaactggaatcaagggaagactgttgtcaaaagc
gacaagcttgtctacgtagaccttctccgagaagaaccagatgctaaaactgacacaaac
gtgtccaaacccagctttgcagcagagagtgttggccagagcgctgagccccccaagccc
tcagttgagccggccctgcagcagcaccgtgatttcatcgccctgagagaggagttgggg
cgcatcagtgacttccacgaaacttatactttcaaacagccagtcttcaccgtaagcaag
gacagtgttctggcaggtaccaacaaagagaacctagggttgccagtctcgactccattc
ctggagccacctctggggagcgatggccctgctgtaacttttggtaaaacccaagaggat
cccaaaccattttgtgtgggcagtgccccaccaagtgtggatgtgacccccacctatacc
aaagatggagctgatgaggctgaatcaaatgatggcaaagttctgaaaccgaagccatct
aagctggcaaagagaatcgccaactcagcgggttacgtgggtgaccgattcaaatgtgtc
actaccgaactgtatgcagattccagtcagctcagccgggagcaacgggcattgcagatg
gaaggattacaagaggacagtattttatgtctacccgctgcttactgtgagcgtgcaatg
atgcgcttctcagagttggagatgaaagaaagagaaggtggccacccagcaaccaaagac
tccgagatgtgcaaattcagcccagccgactgggaaaggttgaaaggaaatcaggacaaa
aagccaaagtcggtcaccctggaggaggccattgcagaacagaacgaaagtgagagatgc
gagtatagtgttggaaacaagcaccgtgatccctttgaagccccagaggacaaagatctt
cctgtggagaagtactttgtggagaggcagcctgtgagcgagcctcccgcagaccaggtg
gcctcggacatgcctcacagccccaccctccgggtggacaggaaacgcaaagtctcaggt
gacagcagccacactgagaccactgcggaggaggtgccagaggaccctctgctgaaagcc
aaacgccgacgagtctctaaagatgactggcctgagagggaaatgacaaacagttcctct
aaccacttagaagacccacattatagtgagctgaccaacctgaaggtgtgcattgaatta
acagggctccatcctaaaaaacaacgccacttgctgcaccttagagaacgatgggagcag
caggtgtcggcagcagatggcaaacctggccggcaaagcaggaaggaagtgacccaggcc
actcagcctgaggccattcctcaggggactaacatcactgaagagaaacctggcaggaaa
agggcagaggccaaaggcaacagaagctggtcggaagagtctcttaaacccagtgacaat
gaacaaggcttgcctgtgttctccggctctccgcccatgaagagtctttcatccaccagt
gcaggcggcaaaaagcaggctcagccaagctgcgcaccagcctccaggccgcctgccaaa
cagcagaaaattaaagaaaaccagaagacagatgtgctgtgtgcagacgaagaagaggat
tgccaggctgcctccctgctgcagaaatacaccgacaacagcgagaagccatccgggaag
agactgtgcaaaaccaaacacttgatccctcaggagtccaggcggggattgccactgaca
ggggaatactacgtggagaatgccgatggcaaggtgactgtccggagattcagaaagcgg
ccggagcccagttcggactatgatctgtcaccagccaagcaggagccaaagcccttcgac
cgcttgcagcaactgctaccagcctcccagtccacacagctgccatgctcaagttcccct
caggagaccacccagtctcgccctatgccgccggaagcacggagacttattgtcaataag
aacgctggcgagacccttctgcagcgggcagccaggcttggctatgaggaagtggtcctg
tactgcttagagaacaagatttgtgatgtaaatcatcgggacaacgcaggttactgcgcc
ctgcatgaagcttgtgctaggggctggctcaacattgtgcgacacctccttgaatatggc
gctgatgtcaactgtagtgcccaggatggaaccaggcctctgcacgatgctgttgagaac
gatcacttggaaattgtccgactacttctctcttatggtgctgaccccaccttggctacg
tactcaggtagaaccatcatgaaaatgacccacagtgaacttatggaaaagttcttaaca
gattatttaaatgacctccagggtcgcaatgatgatgacgccagtggcacttgggacttc
tatggcagctctgtttgtgaaccagatgatgaaagtggctatgatgttttagccaacccc
ccaggaccagaagaccaggatgatgatgacgatgcctatagcgatgtgtttgaatttgaa
ttttcagagacccccctcttaccgtgttataacatccaagtatctgtggctcaggggcca
cgaaactggctactgctttcggatgtccttaagaaattgaaaatgtcctcccgcatattt
cgctgcaattttccaaacgtggaaattgtcaccattgcagaggcagaattttatcggcag
gtttctgcaagtctcttgttctcttgctccaaagacctggaagccttcaaccctgaaagt
aaggagctgttagatctggtggaattcacgaacgaaattcagactctgctgggctcctct
gtagagtggctccaccccagtgatctggcctcagacaactactggtga

DBGET integrated database retrieval system