KEGG   Homo sapiens (human): 699Help
Entry
699               CDS       T01001                                 

Gene name
BUB1, BUB1A, BUB1L, hBUB1
Definition
(RefSeq) BUB1 mitotic checkpoint serine/threonine kinase
  KO
K02178  checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    699 (BUB1)
   04114 Oocyte meiosis
    699 (BUB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    699 (BUB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    699 (BUB1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    699 (BUB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     699 (BUB1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  BUB family
   699 (BUB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     699 (BUB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mad3_BUB1_I Pkinase Mad3_BUB1_I_2 Pkinase_Tyr Inhibitor_I68
Motif
Other DBs
NCBI-GeneID: 699
NCBI-ProteinID: NP_004327
OMIM: 602452
HGNC: 1148
Ensembl: ENSG00000169679
Vega: OTTHUMG00000153638
Pharos: O43683(Tchem)
UniProt: O43683
LinkDB All DBs
Structure
PDB: 

Position
2q13
AA seq 1085 aa AA seqDB search
MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKK
KYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASA
VLQRGIQNQAEPREFLQQQYRLFQTRLTETHLPAQARTSEPLHNVQVLNQMITSKSNPGN
NMACISKNQGSELSGVISSACDKESNMERRVITISKSEYSVHSSLASKVDVEQVVMYCKE
KLIRGESEFSFEELRAQKYNQRRKHEQWVNEDRHYMKRKEANAFEEQLLKQKMDELHKKL
HQVVETSHEDLPASQERSEVNPARMGPSVGSQQELRAPCLPVTYQQTPVNMEKNPREAPP
VVPPLANAISAALVSPATSQSIAPPVPLKAQTVTDSMFAVASKDAGCVNKSTHEFKPQSG
AEIKEGCETHKVANTSSFHTTPNTSLGMVQATPSKVQPSPTVHTKEALGFIMNMFQAPTL
PDISDDKDEWQSLDQNEDAFEAQFQKNVRSSGAWGVNKIISSLSSAFHVFEDGNKENYGL
PQPKNKPTGARTFGERSVSRLPSKPKEEVPHAEEFLDDSTVWGIRCNKTLAPSPKSPGDF
TSAAQLASTPFHKLPVESVHILEDKENVVAKQCTQATLDSCEENMVVPSRDGKFSPIQEK
SPKQALSSHMYSASLLRLSQPAAGGVLTCEAELGVEACRLTDTDAAIAEDPPDAIAGLQA
EWMQMSSLGTVDAPNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEF
QLGSKLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMER
LKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMR
MLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGT
IFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFR
RLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLEC
KRSRK
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atggacaccccggaaaatgtccttcagatgcttgaagcccacatgcagagctacaagggc
aatgaccctcttggtgaatgggaaagatacatacagtgggtagaagagaattttcctgag
aataaagaatacttgataactttactagaacatttaatgaaggaatttttagataagaag
aaataccacaatgacccaagattcatcagttattgtttaaaatttgctgagtacaacagt
gacctccatcaattttttgagtttctgtacaaccatgggattggaaccctgtcatcccct
ctgtacattgcctgggcggggcatctggaagcccaaggagagctgcagcatgccagtgct
gtccttcagagaggaattcaaaaccaggctgaacccagagagttcctgcaacaacaatac
aggttatttcagacacgcctcactgaaacccatttgccagctcaagctagaacctcagaa
cctctgcataatgttcaggttttaaatcaaatgataacatcaaaatcaaatccaggaaat
aacatggcctgcatttctaagaatcagggttcagagctttctggagtgatatcttcagct
tgtgataaagagtcaaatatggaacgaagagtgatcacgatttctaaatcagaatattct
gtgcactcatctttggcatccaaagttgatgttgagcaggttgttatgtattgcaaggag
aagcttattcgtggggaatcagaattttcctttgaagaattgagagcccagaaatacaat
caacggagaaagcatgagcaatgggtaaatgaagacagacattatatgaaaaggaaagaa
gcaaatgcttttgaagaacagctattaaaacagaaaatggatgaacttcataagaagttg
catcaggtggtggagacatcccatgaggatctgcccgcttcccaggaaaggtccgaggtt
aatccagcacgtatggggccaagtgtaggctcccagcaggaactgagagcgccatgtctt
ccagtaacctatcagcagacaccagtgaacatggaaaagaacccaagagaggcacctcct
gttgttcctcctttggcaaatgctatttctgcagctttggtgtccccagccaccagccag
agcattgctcctcctgttcctttgaaagcccagacagtaacagactccatgtttgcagtg
gccagcaaagatgctggatgtgtgaataagagtactcatgaattcaagccacagagtgga
gcagagatcaaagaagggtgtgaaacacataaggttgccaacacaagttcttttcacaca
actccaaacacatcactgggaatggttcaggcaacgccatccaaagtgcagccatcaccc
accgtgcacacaaaagaagcattaggtttcatcatgaatatgtttcaggctcctacactt
cctgatatttctgatgacaaagatgaatggcaatctctagatcaaaatgaagatgcattt
gaagcccagtttcaaaaaaatgtaaggtcatctggggcttggggagtcaataagatcatc
tcttctttgtcatctgcttttcatgtgtttgaagatggaaacaaagaaaattatggatta
ccacagcctaaaaataaacccacaggagccaggacctttggagaacgctctgtcagcaga
cttccttcaaaaccaaaggaggaagtgcctcatgctgaagagtttttggatgactcaact
gtatggggtattcgctgcaacaaaaccctggcacccagtcctaagagcccaggagacttc
acatctgctgcacaacttgcgtctacaccattccacaagcttccagtggagtcagtgcac
attttagaagataaagaaaatgtggtagcaaaacagtgtacccaggcgactttggattct
tgtgaggaaaacatggtggtgccttcaagggatggaaaattcagtccaattcaagagaaa
agcccaaaacaggccttgtcgtctcacatgtattcagcatccttacttcgtctgagccag
cctgctgcaggtggggtacttacctgtgaggcagagttgggcgttgaggcttgcagactc
acagacactgacgctgccattgcagaagatccaccagatgctattgctgggctccaagca
gaatggatgcagatgagttcacttgggactgttgatgctccaaacttcattgttgggaac
ccatgggatgataagctgattttcaaacttttatctgggctttctaaaccagtgagttcc
tatccaaatacttttgaatggcaatgtaaacttccagccatcaagcccaagactgaattt
caattgggttctaagctggtctatgtccatcaccttcttggagaaggagcctttgcccag
gtgtacgaagctacccagggagatctgaatgatgctaaaaataaacagaaatttgtttta
aaggtccaaaagcctgccaacccctgggaattctacattgggacccagttgatggaaaga
ctaaagccatctatgcagcacatgtttatgaagttctattctgcccacttattccagaat
ggcagtgtattagtaggagagctctacagctatggaacattattaaatgccattaacctc
tataaaaatacccctgaaaaagtgatgcctcaaggtcttgtcatctcttttgctatgaga
atgctttacatgattgagcaagtgcatgactgtgaaatcattcatggagacattaaacca
gacaatttcatacttggaaacggatttttggaacaggatgatgaagatgatttatctgct
ggcttggcactgattgacctgggtcagagtatagatatgaaactttttccaaaaggaact
atattcacagcaaagtgtgaaacatctggttttcagtgtgttgagatgctcagcaacaaa
ccatggaactaccagatcgattactttggggttgctgcaacagtatattgcatgctcttt
ggcacttacatgaaagtgaaaaatgaaggaggagagtgtaagcctgaaggtctttttaga
aggcttcctcatttggatatgtggaatgaattttttcatgttatgttgaatattccagat
tgtcatcatcttccatctttggatttgttaaggcaaaagctgaagaaagtatttcaacaa
cactatactaacaagattagggccctacgtaataggctaattgtactgctcttagaatgt
aagcgttcacgaaaataa

DBGET integrated database retrieval system