KEGG   Homo sapiens (human): 7139
Entry
7139              CDS       T01001                                 

Gene name
TNNT2, CMD1D, CMH2, CMPD2, LVNC6, RCM3, TnTC, cTnT
Definition
(RefSeq) troponin T2, cardiac type
  KO
K12045  troponin T, cardiac muscle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Disease
H00292  Hypertrophic cardiomyopathy
H00294  Dilated cardiomyopathy
H01216  Left ventricular noncompaction
H01219  Restrictive cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7139 (TNNT2)
   04261 Adrenergic signaling in cardiomyocytes
    7139 (TNNT2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    7139 (TNNT2)
   05414 Dilated cardiomyopathy
    7139 (TNNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7139 (TNNT2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7139 (TNNT2)
SSDB
Motif
Pfam: Troponin
Other DBs
NCBI-GeneID: 7139
NCBI-ProteinID: NP_001263274
OMIM: 191045
HGNC: 11949
Ensembl: ENSG00000118194
Vega: OTTHUMG00000035733
Pharos: P45379(Tbio)
UniProt: P45379
LinkDB
Structure
PDB: 
4Y99 1J1D 1J1E

Position
1q32.1
AA seq 298 aa
MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEE
EAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHF
ENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAED
EARKKKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLR
EKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtctgacatagaagaggtggtggaagagtacgaggaggaggagcaggaagaagcagct
gttgaagaagaggaggactggagagaggacgaagacgagcaggaggaggcagcggaagag
gatgctgaagcagaggctgagaccgaggagaccagggcagaagaagatgaagaagaagag
gaagcaaaggaggctgaagatggcccaatggaggagtccaaaccaaagcccaggtcgttc
atgcccaacttggtgcctcccaagatccccgatggagagagagtggactttgatgacatc
caccggaagcgcatggagaaggacctgaatgagttgcaggcgctgatcgaggctcacttt
gagaacaggaagaaagaggaggaggagctcgtttctctcaaagacaggatcgagagacgt
cgggcagagcgggccgagcagcagcgcatccggaatgagcgggagaaggagcggcagaac
cgcctggctgaagagagggctcgacgagaggaggaggagaacaggaggaaggctgaggat
gaggcccggaagaagaaggctttgtccaacatgatgcattttgggggttacatccagaag
caggcccagacagagcggaaaagtgggaagaggcagactgagcgggaaaagaagaagaag
attctggctgagaggaggaaggtgctggccattgaccacctgaatgaagatcagctgagg
gagaaggccaaggagctgtggcagagcatctataacttggaggcagagaagttcgacctg
caggagaagttcaagcagcagaaatatgagatcaatgttctccgaaacaggatcaacgat
aaccagaaagtctccaagacccgcgggaaggctaaagtcaccgggcgctggaaatag

DBGET integrated database retrieval system