KEGG   Homo sapiens (human): 7270
Entry
7270              CDS       T01001                                 

Gene name
TTF1, TTF-1, TTF-I
Definition
(RefSeq) transcription termination factor 1
  KO
K15225  transcription termination factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04918  Thyroid hormone synthesis
Network
nt06322  TRH-TSH-TH signaling
  Element
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Disease
H00860  Benign hereditary chorea
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    7270 (TTF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    7270 (TTF1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    Transcription termination factors
     7270 (TTF1)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 7270
NCBI-ProteinID: NP_031370
OMIM: 600777
HGNC: 12397
Ensembl: ENSG00000125482
Vega: OTTHUMG00000020836
Pharos: Q15361(Tbio)
UniProt: Q15361 A0A024R8C1
LinkDB
Position
9q34.13
AA seq 905 aa
MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQ
HLISSPLKKSRICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFR
KDVDVVCVDMSIEQKLPRKPKTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWES
QRARDTLPQSESHQEESWLSVGPGGEITELPASAHKNKSKKKKKKSSNREYETLAMPEGS
QAGREAGTDMQESQPTVGLDDETPQLLGPTHKKKSKKKKKKKSNHQEFEALAMPEGSQVG
SEVGADMQESRPAVGLHGETAGIPAPAYKNKSKKKKKKSNHQEFEAVAMPESLESAYPEG
SQVGSEVGTVEGSTALKGFKESNSTKKKSKKRKLTSVKRARVSGDDFSVPSKNSESTLFD
SVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSAD
SGDADDSDADLGSAVKQLQEFIPNIKDRATSTIKRMYRDDLERFKEFKAQGVAIKFGKFS
VKENKQLEKNVEDFLALTGIESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPW
KLIYYRAKKMFDVNNYKGRYSEGDTEKLKMYHSLLGNDWKTIGEMVARSSLSVALKFSQI
SSQRNRGAWSKSETRKLIKAVEEVILKKMSPQELKEVDSKLQENPESCLSIVREKLYKGI
SWVEVEAKVQTRNWMQCKSKWTEILTKRMTNGRRIYYGMNALRAKVSLIERLYEINVEDT
NEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLE
KMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQ
GRWII
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggaaggagaatcaagcagatttgaaatccacactccagtttctgacaagaaaaagaaa
aagtgttctatacataaggaaagacctcagaaacattcccacgaaattttcagagactcc
tccctggtgaatgaacagtctcaaataactaggaggaaaaagaggaaaaaagatttccag
catctcatttcttctcctttgaaaaaatccagaatctgtgatgagactgcaaatgccact
tccacactcaaaaagagaaaaaagagaagatatagtgctttggaggtggacgaggaagca
ggtgttacagttgtccttgtggataaagaaaatattaacaacacaccaaagcattttaga
aaggatgttgatgttgtttgtgttgatatgagcatagaacagaagttaccaagaaagcct
aaaacagacaaatttcaggtacttgctaagtcacatgcacataaatcagaagccctgcac
agtaaagttagggagaaaaagaataaaaagcatcagaggaaagctgcatcctgggagagc
cagcgggcaagggacaccctgcctcagtcagaatcccaccaggaggagtcctggctttct
gtgggtccagggggtgaaattacagaactaccagcatctgctcataaaaacaagtctaag
aaaaaaaagaaaaagtccagtaaccgggaatatgagacactggccatgcctgaaggatcg
caagcaggcagagaggccgggactgatatgcaggaatcccagcctactgtgggcttggat
gatgaaactccacaactactaggacctactcacaaaaaaaagtctaagaaaaaaaagaag
aaaaagtccaatcaccaggaatttgaggcattggccatgcctgaaggatcacaagtgggc
agtgaggttggggctgatatgcaggaatcccggcctgctgtgggcctgcatggtgaaact
gcaggaataccagcacctgcttataaaaacaagtctaagaaaaaaaagaaaaagtccaat
caccaggaatttgaggcagtggccatgcctgagagcctcgagagtgcataccctgaagga
tcacaggtgggcagtgaggttgggactgtggaaggcagtacagctcttaaagggttcaag
gaatccaacagtacaaagaagaagtctaagaaaaggaagcttacgtctgtcaaaagggca
cgagtgtctggtgatgatttttcagtgcccagtaagaactctgagagcacactctttgat
tcagtagaaggtgatggcgccatgatggaagaaggtgtgaaatctaggccccgacaaaag
aaaacccaggcctgtttggcaagcaagcacgtgcaagaggcgccaaggttagaacctgca
aatgaagaacacaatgtggaaacagctgaagattccgaaataagatacttatctgcagat
tcaggagatgccgatgattcagatgcggatttgggttctgccgtgaaacagcttcaggag
ttcattcctaacatcaaggacagggccaccagcacaatcaagcggatgtaccgggacgac
ttggaacggtttaaggaatttaaagcacaaggtgtcgctattaaatttggcaagttttct
gtaaaggaaaataagcagttagagaaaaatgtggaagactttctagccctgacaggcatt
gagagtgcagacaagctgctgtacacggacagatatcctgaggaaaaatctgtgatcacc
aacttaaaaaggagatactcgtttagattacacattggtaggaacattgcccggccctgg
aaacttatatactatcgagcaaagaagatgttcgatgtcaacaattacaaaggcaggtat
agcgaaggagatactgagaagttaaagatgtaccattctctccttgggaatgactggaag
acgattggtgagatggtggcccgaagtagcctctccgtggccctcaagttctcacagatc
agcagtcaaagaaatcgtggtgcttggagtaagtctgaaacccggaaactaatcaaggct
gtcgaagaagtgattctgaagaagatgtctccccaggagttaaaagaggtggattccaaa
ctccaagaaaatcctgaaagttgcctatcaattgttcgggaaaaactctacaagggcata
tcttgggtagaagtagaagctaaagtgcaaaccagaaattggatgcagtgtaaaagtaag
tggacagaaattctaaccaagaggatgactaatggtcggcgtatctactatggcatgaat
gccctgcgggccaaggtcagccttattgaaaggttgtatgaaataaatgtggaagatact
aatgaaatagactgggaagatcttgctagtgccataggtgatgttcctccatcttacgtt
caaactaaattttctaggctgaaagctgtctatgttccattttggcagaaaaagactttt
ccagagatcatcgactacctttatgagacgactctacctttgctgaaggaaaagttagaa
aaaatgatggagaaaaaaggcactaaaatccagactcctgcagcacccaagcaagttttc
ccatttcgagacatcttttattatgaagacgatagtgaaggagaggacatagaaaaagaa
agcgaaggccaggcgccatgcatggctcacgcctgtaattccagtactttgggaggccaa
ggccggtggatcatctga

DBGET integrated database retrieval system