KEGG   Homo sapiens (human): 84628Help
Entry
84628             CDS       T01001                                 

Gene name
NTNG2, LHLL9381, Lmnt2, NTNG1, bA479K20.1
Definition
(RefSeq) netrin G2
  KO
K16359  netrin-G2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    84628 (NTNG2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    84628 (NTNG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 84628
NCBI-ProteinID: NP_115925
HGNC: 14288
Ensembl: ENSG00000196358
Vega: OTTHUMG00000020835
Pharos: Q96CW9(Tbio)
UniProt: Q96CW9
LinkDB All DBs
Structure
PDB: 

Position
9q34.13
AA seq 530 aa AA seqDB search
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACATAGSFGNCECYGHSN
RCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR
CNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRG
YTGVRCEQPRCDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLAARLGR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatctgctggcgctcttcctgcactgcctccctctggcctctggggactatgac
atctgcaaatcctgggtgaccacagatgagggccccacctgggagttctacgcctgccag
cccaaggtgatgcgcctgaaggactacgtcaaggtgaaggtggagccctcaggcatcaca
tgtggagacccccctgagaggttctgctcccatgagaatccctacctatgcagcaacgag
tgtgacgcctccaacccggacctggcccacccgcccaggctcatgttcgacaaggaggag
gagggcctggccacctactggcagagcatcacctggagccgctaccccagcccgctggaa
gccaacatcaccctttcgtggaacaagaccgtggagctgaccgacgacgtggtgatgacc
ttcgagtacggccggcccacggtcatggtcctggagaagtccctggacaacgggcgcacc
tggcagccctaccagttctacgccgaggactgcatggaggccttcggtatgtccgcccgc
cgggcccgcgacatgtcatcctccagcgcgcaccgcgtgctctgcaccgaggagtactcg
cgctgggcaggctccaagaaggagaagcacgtgcgcttcgaggtgcgggaccgcttcgcc
atctttgccggccccgacctgcgcaacatggacaacctctacacgcggctggagagcgcc
aagggcctcaaggagttcttcaccctcaccgacctgcgcatgcggctgctgcgcccggcg
ctgggcggcacctatgtgcagcgggagaacctctacaagtacttctacgccatctccaac
atcgaggtcatcggcaggtgcaagtgcaacctgcacgccaacctgtgctccatgcgcgag
ggcagcctgcagtgcgagtgcgagcacaacaccaccggccccgactgcggcaagtgcaag
aagaatttccgcacccggtcctggcgggccggctcctacctgccgctgccccatggctct
cccaacgcctgtgccactgcaggttcctttggcaactgcgaatgctacggtcactccaac
cgctgcagctacattgacttcctgaatgtggtgacctgcgtcagctgcaagcacaacacg
cgaggtcagcactgccagcactgccggctgggctactaccgcaacggctcggcagagctg
gatgatgagaacgtctgcattgagtgtaactgcaaccagataggctccgtgcacgaccgg
tgcaacgagaccggcttctgcgagtgccgcgagggcgcggcgggccccaagtgcgacgac
tgcctccccacgcactactggcgccagggctgctaccccaacgtgtgcgacgacgaccag
ctgctgtgccagaacggaggcacctgcctgcagaaccagcgctgcgcctgcccgcgcggc
tacaccggcgtgcgctgcgagcagccccgctgcgaccccgccgacgatgacggcggtctg
gactgcgaccgcgcgcccggggccgccccgcgccccgccaccctgctcggctgcctgctg
ctgctggggctggccgcccgcctgggccgctga

DBGET integrated database retrieval system