KEGG   Homo sapiens (human): 8515Help
Entry
8515              CDS       T01001                                 

Gene name
ITGA10, PRO827
Definition
(RefSeq) integrin subunit alpha 10
  KO
K06586  integrin alpha 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    8515 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    8515 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    8515 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8515 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    8515 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    8515 (ITGA10)
   05414 Dilated cardiomyopathy (DCM)
    8515 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8515 (ITGA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    8515 (ITGA10)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   8515 (ITGA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VCBS FG-GAP_2
Motif
Other DBs
NCBI-GeneID: 8515
NCBI-ProteinID: NP_003628
OMIM: 604042
HGNC: 6135
Ensembl: ENSG00000143127
Vega: OTTHUMG00000013751
Pharos: O75578(Tbio)
UniProt: O75578
LinkDB All DBs
Position
1q21.1
AA seq 1167 aa AA seqDB search
MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREG
RETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEF
PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE
QIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIA
AASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAIS
VVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGSGQ
RLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTSIQ
KLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAYNT
SLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSC
SSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTL
PVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLT
EPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFK
SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLLALL
VFCLWKLGFFAHKKIPEEEKREEKLEQ
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atggaactccccttcgtcactcacctgttcttgcccctggtgttcctgacaggtctctgc
tccccctttaacctggatgaacatcacccacgcctattcccagggccaccagaagctgaa
tttggatacagtgtcttacaacatgttgggggtggacagcgatggatgctggtgggcgcc
ccctgggatgggccttcaggcgaccggaggggggacgtttatcgctgccctgtagggggg
gcccacaatgccccatgtgccaagggccacttaggtgactaccaactgggaaattcatct
catcctgctgtgaatatgcacctggggatgtctctgttagagacagatggtgatggggga
ttcatggcctgtgcccctctctggtctcgtgcttgtggcagctctgtcttcagttctggg
atatgtgcccgtgtggatgcttcattccagcctcagggaagcctggcacccactgcccaa
cgctgcccaacatacatggatgttgtcattgtcttggatggctccaacagcatctacccc
tggtctgaagttcagaccttcctacgaagactggtagggaaactgtttattgacccagaa
cagatacaggtgggactggtacagtatggggagagccctgtacatgagtggtccctggga
gatttccgaacgaaggaagaagtggtgagagcagcaaagaacctcagtcggcgggaggga
cgagaaacaaagactgcccaagcaataatggtggcctgcacagaagggttcagtcagtcc
catgggggccgacccgaggctgccaggctactggtggttgtcactgatggagagtcccat
gatggagaggagcttcctgcagcactaaaggcctgtgaggctggaagagtgacacgctat
gggattgcagtccttggtcactacctccggcggcagcgagatcccagctctttcctgaga
gaaattagaactattgccagtgatccagatgagcgattcttcttcaatgtcacagatgag
gctgctctgactgacattgtggatgcactaggagatcggatttttggccttgaagggtcc
catgcagaaaacgaaagctcctttgggctggaaatgtctcagattggtttctccactcat
cggctaaaggatgggattctttttgggatggtgggggcctatgactggggaggctctgtg
ctatggcttgaaggaggccaccgccttttccccccacgaatggcactggaagacgagttc
ccccctgcattgcagaaccatgcagcctacctgggttactctgtttcttccatgcttttg
cggggtggacgccgcctgtttctctctggggctcctcgatttagacatcgaggaaaagtc
atcgccttccagcttaagaaagatggggctgtgagggttgcccagagcctccagggggag
cagattggttcatactttggcagtgagctctgcccattggatacagatagggatggaaca
actgatgtcttacttgtggctgcccccatgttcctgggaccccagaacaaggaaacagga
cgtgtttatgtgtatctggtaggccagcagtccttgctgaccctccaaggaacacttcag
ccagaacccccccaggatgctcggtttggctttgccatgggagctcttcctgatctgaac
caagatggttttgctgatgtggctgtgggggcgcctctggaagatgggcaccagggagca
ctgtacctgtaccatggaacccagagtggagtcaggccccatcctgcccagaggattgct
gctgcctccatgccacatgccctcagctactttggccgaagtgtggatggtcggctagat
ctggatggagatgatctggtcgatgtggctgtgggtgcccagggggcagccatcctgctc
agctcccggcccattgtccatctgaccccatcactggaggtgaccccacaggccatcagt
gtggttcagagggactgtaggcggcgaggccaagaggcagtctgtctgactgcagccctt
tgcttccaagtgacctcccgtactcctggtcgctgggatcaccaattctacatgaggttc
accgcatcactggatgaatggactgctggggcacgtgcagcatttgatggctctggccag
aggttgtcccctcggaggctccggctcagtgtggggaatgtcacttgtgagcagctacac
ttccatgtgctggatacatcagattacctccggccagtggccttgactgtgacctttgcc
ttggacaatactacaaagccagggcctgtgctgaatgagggctcacccacctctatacaa
aagctggtccccttctcaaaggattgtggccctgacaatgaatgtgtcacagacctggtg
cttcaagtgaatatggacatcagaggctccaggaaggccccatttgtggttcgaggtggc
cggcggaaagtgctggtatctacaactctggagaacagaaaggaaaatgcttacaatacg
agcctgagtctcatcttctctagaaacctccacctggccagtctcactcctcagagagag
agcccaataaaggtggaatgtgccgccccttctgctcatgcccggctctgcagtgtgggg
catcctgtcttccagactggagccaaggtgacctttctgctagagtttgagtttagctgc
tcctctctcctgagccaggtcttcgtgaagctgactgccagcagtgacagcctggagaga
aatgggacccttcaagataacacagcccagacctcagcctacatccaatatgagccccac
ctcctgttctctagtgagtctaccctgcaccgctatgaggttcacccatatgggaccctc
ccagtgggtcctggcccagaattcaaaaccactctcagggttcagaacctaggctgctat
gtggtcagtggcctcatcatctcagccctccttccagctgtggcccatgggggcaattac
ttcctatcactgtctcaagtcatcactaacaatgcaagctgcatagtgcagaacctgact
gaacccccaggcccacctgtgcatccagaggagcttcaacacacaaacagactgaatggg
agcaatactcagtgtcaggtggtgaggtgccaccttgggcagctggcaaaggggactgag
gtctctgttggactattgaggctggttcacaatgaatttttccgaagagccaagttcaag
tccctgacggtggtcagcacctttgagctgggaaccgaagagggcagtgtcctacagctg
actgaagcctcccgttggagtgagagcctcttggaggtggttcagacccggcctatcctc
atctccctgtggatcctcataggcagtgtcctgggagggttgctcctgcttgctctcctt
gtcttctgcctgtggaagcttggcttctttgcccataagaaaatccctgaggaagaaaaa
agagaagagaagttggagcaatga

DBGET integrated database retrieval system