KEGG   Homo sapiens (human): 8651
Entry
8651              CDS       T01001                                 

Gene name
SOCS1, CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP-3, TIP3
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04380  Osteoclast differentiation
hsa04630  JAK-STAT signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04935  Growth hormone synthesis, secretion and action
hsa05145  Toxoplasmosis
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8651 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    8651 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8651 (SOCS1)
   04917 Prolactin signaling pathway
    8651 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    8651 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    8651 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    8651 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    8651 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    8651 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8651 (SOCS1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     8651 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 8651
NCBI-ProteinID: NP_003736
OMIM: 603597
HGNC: 19383
Ensembl: ENSG00000185338
Vega: OTTHUMG00000129792
Pharos: O15524(Tbio)
UniProt: O15524 Q4JHT5
LinkDB
Position
16p13.13
AA seq 211 aa
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 636 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagccccga
cggcggccagaaccttcctcctcttcctcctcctcgcccgcggcccccgcgcgcccgcgg
ccgtgccccgcggtcccggccccggcccccggcgacacgcacttccgcacattccgttcg
cacgccgattaccggcgcatcacgcgcgccagcgcgctcctggacgcctgcggattctac
tgggggcccctgagcgtgcacggggcgcacgagcggctgcgcgccgagcccgtgggcacc
ttcctggtgcgcgacagccgccagcggaactgctttttcgcccttagcgtgaagatggcc
tcgggacccacgagcatccgcgtgcactttcaggccggccgctttcacctggatggcagc
cgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcggcgccgcgccgc
atgctgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgccgccag
cgcatcgtggccaccgtgggccgcgagaacctggctcgcatccccctcaaccccgtcctc
cgcgactacctgagctccttccccttccagatttga

KEGG   Homo sapiens (human): 8835
Entry
8835              CDS       T01001                                 

Gene name
SOCS2, CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  JAK-STAT signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    8835 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8835 (SOCS2)
   04917 Prolactin signaling pathway
    8835 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    8835 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    8835 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8835 (SOCS2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     8835 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 8835
NCBI-ProteinID: NP_001257396
OMIM: 605117
HGNC: 19382
Ensembl: ENSG00000120833
Vega: OTTHUMG00000170160
Pharos: O14508(Tbio)
UniProt: O14508 A0A024RBD2
LinkDB
Structure
PDB: 

Position
12q22
AA seq 198 aa
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgccttgagccctccgggaatggcggggaagggacgcggagccagtgg
gggaccgcggggtcggcggaggagccatccccgcaggcggcgcgtctggcgaaggccctg
cgggagctcggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgaatcgaataccaa
gacggaaaattcagattggactctatcatatgtgtcaaatccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagccccccggaacggcactgttcacctttatctgaccaaaccgctctacacgtcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtaccggtgccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Homo sapiens (human): 9021
Entry
9021              CDS       T01001                                 

Gene name
SOCS3, ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04380  Osteoclast differentiation
hsa04630  JAK-STAT signaling pathway
hsa04668  TNF signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04935  Growth hormone synthesis, secretion and action
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Network
nt06122  IFN signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00576  HSV UL41/UL13 to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9021 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    9021 (SOCS3)
   04668 TNF signaling pathway
    9021 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    9021 (SOCS3)
   04920 Adipocytokine signaling pathway
    9021 (SOCS3)
   04917 Prolactin signaling pathway
    9021 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    9021 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    9021 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    9021 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    9021 (SOCS3)
   04931 Insulin resistance
    9021 (SOCS3)
  09172 Infectious disease: viral
   05164 Influenza A
    9021 (SOCS3)
   05160 Hepatitis C
    9021 (SOCS3)
   05168 Herpes simplex virus 1 infection
    9021 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9021 (SOCS3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     9021 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 9021
NCBI-ProteinID: NP_003946
OMIM: 604176
HGNC: 19391
Ensembl: ENSG00000184557
Vega: OTTHUMG00000177513
Pharos: O14543(Tbio)
UniProt: O14543 Q6FI39
LinkDB
Position
17q25.3
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agtgccgagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctgggagtccc
cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

DBGET integrated database retrieval system