KEGG   Homo sapiens (human): 8766Help
Entry
8766              CDS       T01001                                 

Gene name
RAB11A, YL8
Definition
(RefSeq) RAB11A, member RAS oncogene family
  KO
K07904  Ras-related protein Rab-11A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04972  Pancreatic secretion
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8766 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    8766 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    8766 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    8766 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    8766 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8766 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8766 (RAB11A)
   04031 GTP-binding proteins [BR:hsa04031]
    8766 (RAB11A)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    8766 (RAB11A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8766 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   8766 (RAB11A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    8766 (RAB11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 Gtr1_RagA FeoB_N ABC_tran PduV-EutP SRPRB AAA_14 AAA_24 TniB FAD-SLDH MCM AAA_7 AAA_5 AAA_21
Motif
Other DBs
NCBI-GeneID: 8766
NCBI-ProteinID: NP_004654
OMIM: 605570
HGNC: 9760
Ensembl: ENSG00000103769
Vega: OTTHUMG00000133162
Pharos: P62491(Tbio)
UniProt: P62491 A0A024R5Z8
LinkDB All DBs
Structure
PDB: 

Position
15q22.31
AA seq 216 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctctttaaagttgtccttattggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatctggaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatggaaaaacaata
aaggcacagatatgggacacagcagggcaagagcgatatcgagctataacatcagcatat
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatctacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatggtttgtcattcattgaaacttcggccctagactctacaaat
gtagaagctgcttttcagacaattttaacagagatttaccgcattgtttctcagaagcaa
atgtcagacagacgcgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatctaa

KEGG   Homo sapiens (human): 9230Help
Entry
9230              CDS       T01001                                 

Gene name
RAB11B, H-YPT3, NDAGSCW
Definition
(RefSeq) RAB11B, member RAS oncogene family
  KO
K07905  Ras-related protein Rab-11B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    9230 (RAB11B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9230 (RAB11B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    9230 (RAB11B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    9230 (RAB11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9230 (RAB11B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9230 (RAB11B)
   04031 GTP-binding proteins [BR:hsa04031]
    9230 (RAB11B)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    9230 (RAB11B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9230 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   9230 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   9230 (RAB11B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    9230 (RAB11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 AAA_22 RsgA_GTPase GTP_EFTU Gtr1_RagA AAA_16 FeoB_N ABC_tran PduV-EutP SRPRB AAA_14 TniB AAA_24 FAD-SLDH AAA_21 AAA_5 AAA_7
Motif
Other DBs
NCBI-GeneID: 9230
NCBI-ProteinID: NP_004209
OMIM: 604198
HGNC: 9761
Ensembl: ENSG00000185236
Vega: OTTHUMG00000182278
Pharos: Q15907(Tbio)
UniProt: Q15907
LinkDB All DBs
Structure
PDB: 

Position
19p13.2
AA seq 218 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca
ggcgtgggcaagagcaacctgctgtcgcgcttcacccgcaacgagttcaacctggagagc
aagagcaccatcggcgtggagttcgccacccgcagcatccaggtggacggcaagaccatc
aaggcgcagatctgggacaccgctggccaggagcgctaccgcgccatcacctccgcgtac
taccgtggtgcagtgggcgccctgctggtgtacgacatcgccaagcacctgacctatgag
aacgtggagcgctggctgaaggagctgcgggaccacgcagacagcaacatcgtcatcatg
ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggcccgc
gccttcgcagaaaagaacaacttgtccttcatcgagacctcagccttggattccactaac
gtagaggaagcattcaagaacatcctcacagagatctaccgcatcgtgtcacagaaacag
atcgcagaccgcgctgcccacgacgagtccccggggaacaacgtggtggacatcagcgtg
ccgcccaccacggacggacagaagcccaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system