KEGG   Homo sapiens (human): 9319
Entry
9319              CDS       T01001                                 

Gene name
TRIP13, 16E1BP, MVA3, OOMD9
Definition
(RefSeq) thyroid hormone receptor interactor 13
  KO
K22399  pachytene checkpoint protein 2
Organism
hsa  Homo sapiens (human)
Disease
H01288  Mosaic variegated aneuploidy syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9319 (TRIP13)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Others
     9319 (TRIP13)
SSDB
Motif
Pfam: AAA AAA_22 AAA_18 AAA_16 AAA_33 AAA_14 AAA_25 Cytidylate_kin TsaE RuvB_N AAA_5 RNA_helicase AAA_28 IstB_IS21 AAA_11 DUF815 AAA_24 AAA_7 AAA_30 NACHT Viral_helicase1 ABC_tran TIP49 ATPase PduV-EutP PhoH Mg_chelatase AAA_17 Rad17 AAA_19 AAA_2 DUF2075 AAA_3 NTPase_1
Other DBs
NCBI-GeneID: 9319
NCBI-ProteinID: NP_004228
OMIM: 604507
HGNC: 12307
Ensembl: ENSG00000071539
Vega: OTTHUMG00000090349
Pharos: Q15645(Tbio)
UniProt: Q15645
LinkDB
Structure
PDB: 
5WC2 5VQA 5VQ9 6F0X

Position
5p15.33
AA seq 432 aa
MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTE
FDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENII
AANHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGP
PGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLI
DDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSN
ITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIG
FIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK
QFEERKKLAAYI
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggacgaggccgtgggcgacctgaagcaggcgcttccctgtgtggccgagtcgccaacg
gtccacgtggaggtgcatcagcgcggcagcagcactgcaaagaaagaagacataaacctg
agtgttagaaagctactcaacagacataatattgtgtttggtgattacacatggactgag
tttgatgaaccttttttgaccagaaatgtgcagtctgtgtctattattgacacagaatta
aaggttaaagactcacagcccatcgatttgagtgcatgcactgttgcacttcacattttc
cagctgaatgaagatggccccagcagtgaaaatctggaggaagagacagaaaacataatt
gcagcaaatcactgggttctacctgcagctgaattccatgggctttgggacagcttggta
tacgatgtggaagtcaaatcccatctcctcgattatgtgatgacaactttactgttttca
gacaagaacgtcaacagcaacctcatcacctggaaccgggtggtgctgctccacggtcct
cctggcactggaaaaacatccctgtgtaaagcgttagcccagaaattgacaattagactt
tcaagcaggtaccgatatggccaattaattgaaataaacagccacagcctcttttctaag
tggttttcggaaagtggcaagctggtaaccaagatgtttcagaagattcaggatttgatt
gatgataaagacgccctggtgttcgtgctgattgatgaggtggagagtctcacagccgcc
cgaaatgcctgcagggcgggcaccgagccatcagatgccatccgcgtggtcaatgctgtc
ttgacccaaattgatcagattaaaaggcattccaatgttgtgattctgaccacttctaac
atcaccgagaagatcgacgtggccttcgtggacagggctgacatcaagcagtacattggg
ccaccctctgcagcagccatcttcaaaatctacctctcttgtttggaagaactgatgaag
tgtcagatcatataccctcgccagcagctgctgaccctccgagagctagagatgattggc
ttcattgaaaacaacgtgtcaaaattgagccttcttttgaatgacatttcaaggaagagc
gagggcctcagcggccgggtcctgagaaaactcccctttctggctcatgcgctgtatgtc
caggcccccaccgtcaccatagaggggttcctccaggccctgtctctggcagtggacaag
cagtttgaagagagaaagaagcttgcagcttacatctga

DBGET integrated database retrieval system