KEGG   Loxodonta africana (African savanna elephant): 100653632
Entry
100653632         CDS       T04351                                 

Gene name
TPM2
Definition
(RefSeq) tropomyosin beta chain isoform X3
  KO
K10374  tropomyosin 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100653632 (TPM2)
   04261 Adrenergic signaling in cardiomyocytes
    100653632 (TPM2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100653632 (TPM2)
   05414 Dilated cardiomyopathy
    100653632 (TPM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100653632 (TPM2)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100653632 (TPM2)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II ERM TMF_DNA_bd Crescentin DUF3450 SNARE Cluap1 Snapin_Pallidin DASH_Duo1 ADIP ATG16 CENP-F_leu_zip HrpB7 Suppressor_APC DUF1664 Laminin_I
Other DBs
NCBI-GeneID: 100653632
NCBI-ProteinID: XP_003407342
LinkDB
Position
Unknown
AA seq 284 aa
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKDAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEQAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLELNNL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctaaagctggacaaggagaatgctatcgat
cgcgccgagcaggccgaggccgacaagaaacaagctgaggaccgctgcaagcagctggag
gaggagcagcaagccctccagaagaagctgaaggggacggaggacgaggtggaaaagtat
tctgagtcagtgaaggatgcccaggagaaactggagcaggctgagaagaaagccacagac
gccgaggcagatgtggcctccctgaaccgccgcattcagctagtagaggaggagctggac
cgggcacaggagcgtctggccactgccctgcaaaagctggagcaggctgagaaggcagcc
gatgagagtgagagaggaatgaaggtcattgaaaaccgggccatgaaggatgaggaaaag
atggagcttcaggagatgcagctgaaggaggccaagcacattgctgaggactcagaccgc
aaatacgaggaggtggccaggaagctggtgatcctggaaggagagctagaacgctcagaa
gagagggctgaggtggctgagagtaaatgtggggacctagaggaagaactgaaaattgtt
accaacaacttgaaatccctggaggcccaagcagacaagtattccaccaaagaggataaa
tatgaagaggagatcaaactgctggaggagaaactgaaggaggctgagacccgagcagaa
tttgccgaaagatctgtggcaaaactggagaaaaccatcgatgacctagaagagaccttg
gccagtgccaaggaggagaatgtggagattcaccagaccctggaccagaccctgctggaa
ctcaacaacctctga

KEGG   Loxodonta africana (African savanna elephant): 100666675
Entry
100666675         CDS       T04351                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain isoform X5
  KO
K10373  tropomyosin 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav05206  MicroRNAs in cancer
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100666675 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100666675 (TPM1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100666675 (TPM1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100666675 (TPM1)
   05414 Dilated cardiomyopathy
    100666675 (TPM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100666675 (TPM1)
   04147 Exosome [BR:lav04147]
    100666675 (TPM1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100666675 (TPM1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100666675 (TPM1)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II TMF_DNA_bd ERM COG2 ADIP Laminin_I DUF745 Fib_alpha ATG16 AAA_13 HrpB7 DUF1664 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 100666675
NCBI-ProteinID: XP_003418384
LinkDB
Position
Unknown
AA seq 284 aa
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgccttggat
cgagccgagcaggcggaggcggataagaaggccgctgaagaccggagcaagcagctggaa
gacgagctggtatcgctgcaaaagaaactcaagggcactgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaagctggagctggctgagaaaaaggccacggat
gctgaagccgatgtagcgtctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggccacagctttgcagaagctggaggaggccgagaaggcagca
gacgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaggatgaggaaaaa
atggaaattcaggagatccaactcaaagaggccaagcacattgctgaagatgcagaccgc
aagtacgaggaggtggcccgtaagctggtcatcattgagagtgaccttgaacgtgcagag
gagagggctgagctctcagaaggccaagttcgacagctggaagaacaattaagaataatg
gatcagaccttgaaagcattaatggctgcagaggataagtactcgcagaaggaggacaag
tatgaggaagagatcaaggtcctttctgacaagctgaaggaggctgagacacgggccgag
tttgcagagaggtcagtaactaaattggagaaaagcattgatgacttagaagagaaagtg
gctcatgccaaagaagaaaaccttagtatgcatcagatgctggatcagactttactggag
ttaaacaacatgtga

KEGG   Loxodonta africana (African savanna elephant): 100671189
Entry
100671189         CDS       T04351                                 

Gene name
TPM4
Definition
(RefSeq) tropomyosin alpha-4 chain
  KO
K10375  tropomyosin 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100671189 (TPM4)
   04261 Adrenergic signaling in cardiomyocytes
    100671189 (TPM4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100671189 (TPM4)
   05414 Dilated cardiomyopathy
    100671189 (TPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100671189 (TPM4)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100671189 (TPM4)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II ATG16 DUF3450 ERM Laminin_I Crescentin DUF1664 FPP CENP-F_leu_zip NBP1 HrpB7 CCDC144C XhlA DHR10 GAS ADIP FliJ TPR_MLP1_2 Spc7
Other DBs
NCBI-GeneID: 100671189
NCBI-ProteinID: XP_003413090
LinkDB
Position
Unknown
AA seq 284 aa
MEAIKKKMQMLKLDKENAIDRAEQAEADKKAAEDKCKQVEEELTHLQKKLKGTEDELDMY
SENLKDAQEKLELTEKKASDAEGDVAALNRRIQLVEEELDRAQERLAAALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVVLEGELERAE
ERAEVAELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLVSDKLKEAETRAE
FAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaggccatcaagaagaagatgcagatgctgaagctggacaaggagaacgccatcgac
cgcgctgagcaggcggaggccgacaagaaggccgccgaggacaagtgtaagcaggtggag
gaggagctaacacacctccagaaaaagctgaaggggacggaagacgagctggacatgtac
tcggagaacctgaaggacgcgcaggagaagctggagctgactgagaagaaagcctccgat
gctgaaggtgatgtggcagctctcaaccgacgcatccagcttgtggaggaggagctggac
agggctcaggagcgcctggctgcggccctgcagaaactggaggaggcggagaaggctgca
gatgaaagtgagagaggcatgaaggtgatagagaaccgggccatgaaagacgaggagaag
atggaaatccaggagatgcagctcaaagaggccaagcacattgctgaggaggccgaccgc
aaatacgaggaggtagctcgtaagctggtcgtcctggagggcgagctggagcgagcagag
gaacgtgcagaggtggctgaactaaaatgtggtgacctggaagaagaactcaagaatgtc
acaaacaatctgaaatcgctggaggcggcctcagaaaagtattctgaaaaggaggataaa
tatgaagaagaaattaaacttgtgtctgacaaactgaaagaggctgagacccgtgctgag
tttgcagagagaacggttgcaaaactggaaaagaccattgatgacctggaagaaaaactt
gcccaggccaaagaagagaacgtgggcttacatcagacactggatcagacactaaacgaa
cttaactgtatataa

KEGG   Loxodonta africana (African savanna elephant): 100674827
Entry
100674827         CDS       T04351                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X1
  KO
K09290  tropomyosin 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav05200  Pathways in cancer
lav05216  Thyroid cancer
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100674827 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    100674827 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674827 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100674827 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100674827 (TPM3)
   05414 Dilated cardiomyopathy
    100674827 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100674827 (TPM3)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100674827 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CLZ CENP-F_leu_zip WES_acyltransf DUF745 DUF1664 EzrA BORCS7 Lebercilin MAD Fib_alpha Crescentin
Other DBs
NCBI-GeneID: 100674827
NCBI-ProteinID: XP_003415144
UniProt: G3TYJ3
LinkDB
Position
Unknown
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILSDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggccgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gccgatgatgccgaggagagggccgagcgcctccagcgggaagtggagggggaaaggcgg
gcccgggaacaggctgaggctgaggtggcctccttgaaccgtcggatccagctggttgaa
gaggagctggaccgtgctcaggagcgtctggccactgccctgcaaaagctggaggaggca
gagaaagctgctgatgagagcgagagaggtatgaaggttattgaaaaccgggccttaaaa
gatgaagagaagatggaactccaggaaatccaactcaaagaagctaaacacattgcagaa
gaggcagatcggaagtacgaggaggtggctcgtaagttggtgattattgaaggggacttg
gaacgcacagaggagcgagctgagctggcagagtcccgttgccgagagatggatgagcag
atcagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagataaagatactttctgataaactcaaggaggcagag
acccgtgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgatttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

DBGET integrated database retrieval system