KEGG   Loxodonta africana (African savanna elephant): 100653766
Entry
100653766         CDS       T04351                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X2
  KO
K06279  SHC-transforming protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04510  Focal adhesion
lav04650  Natural killer cell mediated cytotoxicity
lav04722  Neurotrophin signaling pathway
lav04910  Insulin signaling pathway
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05034  Alcoholism
lav05100  Bacterial invasion of epithelial cells
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05220  Chronic myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100653766 (SHC1)
   04014 Ras signaling pathway
    100653766 (SHC1)
   04072 Phospholipase D signaling pathway
    100653766 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100653766 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100653766 (SHC1)
   04062 Chemokine signaling pathway
    100653766 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100653766 (SHC1)
   04915 Estrogen signaling pathway
    100653766 (SHC1)
   04917 Prolactin signaling pathway
    100653766 (SHC1)
   04926 Relaxin signaling pathway
    100653766 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    100653766 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100653766 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100653766 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100653766 (SHC1)
   05226 Gastric cancer
    100653766 (SHC1)
   05214 Glioma
    100653766 (SHC1)
   05220 Chronic myeloid leukemia
    100653766 (SHC1)
   05224 Breast cancer
    100653766 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    100653766 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100653766 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100653766 (SHC1)
   01522 Endocrine resistance
    100653766 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100653766
NCBI-ProteinID: XP_003415155
UniProt: G3T4J5
LinkDB
Position
Unknown
AA seq 583 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPVGGRPGPRGEPGRAAEDGEGIAGAAMLDSGPLHLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNEKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGATPGAARPTPPGGQTPSHLGATLPVGQPVGGEPEVRKQMPPLQPCPGRE
LFDDPSYVNVQNLDKVRQAGGGGGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQLMSMA
EQLREEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggatctccttccccccaagcccaagtacaacccacttcggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccacgcccccggaggagctgccttccccatcagcctca
tccttagggcccatcctgccacctctgcctggggacgacagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaaactggccaacccagttggggggcgaccagggcca
agaggggaaccaggaagggcagccgaggatggggaggggatcgcaggggcagccatgctg
gactcaggccccctgcacctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgagaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtgctgcagtccatgcgtgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcaacaaggaggagaaagccctgtagccgcccactcagctccatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcacagtctccaccagcagc
cttaacctcatggcagctgactgcaaacagatcattgccaaccaccacatgcaatccatc
tcgtttgcatccggcggggacccggacacagctgaatatgtcgcctacgttgccaaagac
cccgtgaatcagagagcctgccacatcttggagtgtcctgaagggcttgctcaggatgtc
atcagcaccattggccaggcctttgagttgcgcttcaaacagtacctcaggaatccaccc
aagctagtcactccccacgacaggatggctggctttgatggctcagcttgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccctctt
gggggggtggtggacatgaggcttcgggaaggagccaccccaggggctgctcggcccact
ccgcctggtggccagacccccagccacttgggggctaccttgcctgtgggtcagcctgtc
gggggggaacctgaagtccgcaaacagatgccacctctgcaaccttgcccaggtagagag
ctctttgatgatccctcctatgtcaacgtccagaacttagacaaggtccggcaagcaggg
ggcgggggcgggccccccaatcctgccatcaatggcagtgcaccccgggacctctttgac
atgaagccctttgaagatgcccttcgggtgcctccacctccccagttgatgtccatggct
gagcagctccgagaggagccctggttccacgggaagctgagccggcgggaggctgaggca
ctgctgcagctcaacggggacttcctggtgcgggagagcacaaccacacccggccagtat
gtgctcaccggcttgcagagtggtcagcccaagcacttgctactggtggaccctgagggt
gtggttcggacaaaggatcatcgtttcgagagtgtcagtcatctcatcagctaccacatg
gacaatcacttgcccatcatctctgcgggcagcgaactgtgtctacagcagcctgtggag
cggaaactgtga

KEGG   Loxodonta africana (African savanna elephant): 100654827
Entry
100654827         CDS       T04351                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04510  Focal adhesion
lav04650  Natural killer cell mediated cytotoxicity
lav04722  Neurotrophin signaling pathway
lav04910  Insulin signaling pathway
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05034  Alcoholism
lav05100  Bacterial invasion of epithelial cells
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05220  Chronic myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100654827 (SHC4)
   04014 Ras signaling pathway
    100654827 (SHC4)
   04072 Phospholipase D signaling pathway
    100654827 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100654827 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100654827 (SHC4)
   04062 Chemokine signaling pathway
    100654827 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100654827 (SHC4)
   04915 Estrogen signaling pathway
    100654827 (SHC4)
   04917 Prolactin signaling pathway
    100654827 (SHC4)
   04926 Relaxin signaling pathway
    100654827 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    100654827 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100654827 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100654827 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100654827 (SHC4)
   05226 Gastric cancer
    100654827 (SHC4)
   05214 Glioma
    100654827 (SHC4)
   05220 Chronic myeloid leukemia
    100654827 (SHC4)
   05224 Breast cancer
    100654827 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    100654827 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100654827 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100654827 (SHC4)
   01522 Endocrine resistance
    100654827 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100654827
NCBI-ProteinID: XP_003420183
UniProt: G3T2F1
LinkDB
Position
Unknown
AA seq 630 aa
MRERGQDGLAGLALCVGLFGHAAMLHRAKYSRFRNESVTSLDEGSPGGAVGAKGAPLPPY
PALAPHPPAEEATLAPQESPTPLCTLIPRMASVKLASPATLLSLKNFCLGTKEVLRLKLQ
DSQEAAPGRPASPETSQNRAGSAPAPQPEPVGHRAHALTPDVCPLPGPGEPVPGIRQDRH
FLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIRKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
RPDGSAEEREDREYYNEIPGKPPPAGGVSDVRVTVPAAEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAAGHAHERGVQPQQDTSLLKHTCRVDLFDDPCYINTQAFQSTLGSAWH
QSSAQTLGSPWHHGKAPATVQPGATAQSAGTCSLPQIKQQLRNEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHIFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDSNPGLLDSNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagagcgcggtcaggacggcctggcaggactcgcgctgtgtgtaggactcttcggg
cacgccgcgatgctgcaccgggccaagtacagccgctttcggaacgagtccgtcacgtcc
ttggacgaaggcagccccggaggcgcggtcggggccaagggcgctccgctgcccccctac
cccgccttggcacctcatccgccggcggaagaagccaccctggcgccccaggagagcccc
acgccgctctgcaccttgatcccccgcatggcgagtgtgaagctggccagcccggctacc
ttgctgagtctgaagaacttctgcctggggaccaaagaggtgcttcggctaaagctccag
gacagccaggaggccgctccgggccgccctgcttcccccgaaaccagtcaaaacagggcc
gggtctgcacctgcgccccagcccgagccggtagggcacagagcacacgccttaactccc
gacgtctgcccgcttccgggccctggggagccggtccctgggatcaggcaggacagacac
tttctccagcacctgttggggatgggcatgaactactatgtgcggtacatgggctgtatt
gaagtgctgcaatcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggagcaaatggagccattagaaagcgaaag
cctccagttaaattcctatcaacagttcttggcaaaagtaaccttcagttttcgggaatg
aatataaaactgaccatctcaacatgtagcctcacactgatgaatctcgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgtcacatactg
gaatgccgcagtggaatggcccaagatgtcatcagtaccatcgggcaggcctttgaactc
cggtttaaacagtacttgaaaaatccttctttgaatacttcctgtgaaagtgaggaggtg
cgccctgacggcagtgccgaggagagagaagaccgtgagtactacaatgaaatcccaggg
aagccgccacctgccggcggtgtttccgatgtgcgggtgacagttccagctgcagagcaa
atggcttactgcccaatacggtgtgagaagttgtgctatctgcctggaaactccaagtgc
agcagtgtatacgagaactgtttagaacaaagcagggcagcgggtcacgcccatgagaga
ggggtacagccccagcaagacacctcgttactgaagcacacgtgtcgagtggacctcttt
gatgacccctgctacattaacactcaggcttttcaaagtactcttggctctgcttggcat
caaagctcagctcagacgcttgggagcccgtggcaccatggaaaggcaccggcaactgtc
cagccaggcgccacagcccagtctgctggcacatgttctttgccacaaattaagcagcag
ctgcgaaatgaagactgctaccacggcaagctgagcaggaaggcagcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacatcccctggccaatatgtgctg
agtggactgcagggaggccaggcaaaacatcttctcctggtggatcctgaaggcaaggtg
aggaccaaagatcatatattcgataatgtcggccaccttatcagataccacatggataac
agtttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtgagaaaagat
agtaatccaggacttttggattccaacaaatga

KEGG   Loxodonta africana (African savanna elephant): 100659669
Entry
100659669         CDS       T04351                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04510  Focal adhesion
lav04650  Natural killer cell mediated cytotoxicity
lav04722  Neurotrophin signaling pathway
lav04910  Insulin signaling pathway
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05034  Alcoholism
lav05100  Bacterial invasion of epithelial cells
lav05214  Glioma
lav05220  Chronic myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100659669 (SHC3)
   04014 Ras signaling pathway
    100659669 (SHC3)
   04072 Phospholipase D signaling pathway
    100659669 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100659669 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100659669 (SHC3)
   04062 Chemokine signaling pathway
    100659669 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100659669 (SHC3)
   04915 Estrogen signaling pathway
    100659669 (SHC3)
   04917 Prolactin signaling pathway
    100659669 (SHC3)
   04926 Relaxin signaling pathway
    100659669 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    100659669 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100659669 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100659669 (SHC3)
   05226 Gastric cancer
    100659669 (SHC3)
   05214 Glioma
    100659669 (SHC3)
   05220 Chronic myeloid leukemia
    100659669 (SHC3)
   05224 Breast cancer
    100659669 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    100659669 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100659669 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100659669 (SHC3)
   01522 Endocrine resistance
    100659669 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 100659669
NCBI-ProteinID: XP_003421619
LinkDB
Position
Unknown
AA seq 618 aa
MLQRTKYNRFRNDSVTSVDELIHNLSMSGGSSGGGKVSAVPATSAASPYLVSSEALRKAP
DDGPSSLGHLLHKVSHLKLSTSGLRSLSSAARERAGAKLTGSCSAPSLAAGAPDRTCARA
PAPGSARPAPREMSAARKGRPGEELLPRHPRGWLHASDQVLGPGVTYVVKYLGCIEVLRS
MRSLDFSTRTQITREAISRVCEAVPGARGAIKKRKPPSKMLSSILGKSNLQFAGMSISLT
ISTTSLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCGG
LAQDVISSIGQAFELRFKQYLQCPSKMPALQDRMQSLDEPWTKEEGDDSDHPYYNSMPNK
VPPPGGFHDARQKVRPYVPDTAQFAGKEQTYYQGRHLGDKFGEDWQQPSVRQGSLDIYSM
PERKSLEAPPGVAPTYVNTQNIPQQAGLTQAGAALNMDTGAASSSGENSPRKDLFDMKPF
EDALKNQTMGPMLSKAASVECISPIPPRAPDAKMVEELKEEPWYQGEMSRKEAEGLLKKD
GDFLVRRSTTNSGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVFDSIGHLINHHLENGIP
IVSAGSDLCLQQPVERKH
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgctgcaacggaccaagtataatcgcttcaggaatgattcggtgacatcagtcgatgaa
cttatccacaacctgtccatgagcggcggcagcagcggcggcggcaaggtctcagcggtg
cccgcgacctccgcggcgtccccctacctggtctccagtgaggcgctgcgcaaagcgccg
gacgatgggcccagcagcctgggccacctgctccacaaggtgtcccacctgaaactctcc
acctcgggcctccgtagcctgtcgtccgccgcgagggagcgggccggcgccaagctcacc
ggcagctgcagcgctcccagcctggccgccggcgccccggaccgcacatgtgcccgcgcc
ccggccccaggcagtgcgcggccggccccgagagagatgagcgccgccaggaagggccgg
cccggcgaggagctgctgcccaggcacccccggggctggctgcacgccagcgaccaggtc
ttggggcccggagtgacgtacgtcgtcaagtacttggggtgcattgaagttctgcgctca
atgaggtctcttgacttcagtacaagaacacaaattaccagggaagccatcagccgtgtt
tgtgaagctgttcctggtgccagaggagccatcaagaaaaggaagcctccaagcaaaatg
ctgtccagcatcttgggaaagagcaacctccagtttgcaggaatgagtatctctctcacc
atttccaccaccagcctgaatctgcggacacctgactccaaacagatcattgcaaaccat
cacatgcagtccatctcctttgcctccggaggagacccggacacaacagactatgttgcc
tatgtagctaaagaccctgttaatcgcagagcttgtcacatactggaatgttgtggaggg
ctggcccaggatgtcatcagctccattggacaagccttcgagcttcggtttaagcaatat
ttacagtgtccttccaagatgcctgctcttcaagatcggatgcagagtctggatgagcca
tggaccaaagaagagggagatgattctgaccatccatactacaatagcatgccaaacaag
gtgcctcctccaggggggtttcatgatgctcgacagaaagttaggccctatgttcctgac
acagcccagttcgcaggaaaagagcaaacttattaccagggaagacacttaggagacaag
ttcggtgaagactggcaacaaccatctgttagacaagggtctttggacatctacagcatg
ccagaaagaaagtcacttgaggcccctccaggagtagcacccacctacgtcaatacccag
aacatcccacagcaggctgggctgacccaggcaggagctgcactgaacatggacacggga
gccgccagcagcagtggagaaaacagcccgcggaaagatttgtttgacatgaagcctttt
gaagatgctctcaagaaccagaccatgggacccatgttaagcaaggctgcctccgtagag
tgcatcagccccatcccgcccagagccccagatgccaagatggtggaagaactaaaggaa
gagccatggtaccaaggagagatgagcaggaaggaggcggaggggctgctcaagaaggat
ggggacttcctggtcagaagaagtaccacaaactccggttccttcgtcctcacgggcatg
cacaacggccaggccaagcacctgctgctggtggatcctgaaggcacgatccgcaccaag
gacagggtctttgacagcatcggccatctcatcaaccaccacctggagaacggcataccc
atcgtctctgccgggagtgacctctgcctccagcagccagtggaaagaaagcactga

DBGET integrated database retrieval system