KEGG   Mus caroli (Ryukyu mouse): 110287188
Entry
110287188         CDS       T05910                                 

Gene name
Ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01523  Antifolate resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04380  Osteoclast differentiation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04668  TNF signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05212  Pancreatic cancer
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05340  Primary immunodeficiency
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110287188 (Ikbkg)
   04014 Ras signaling pathway
    110287188 (Ikbkg)
   04064 NF-kappa B signaling pathway
    110287188 (Ikbkg)
   04668 TNF signaling pathway
    110287188 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    110287188 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110287188 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110287188 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    110287188 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    110287188 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    110287188 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    110287188 (Ikbkg)
   04660 T cell receptor signaling pathway
    110287188 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    110287188 (Ikbkg)
   04659 Th17 cell differentiation
    110287188 (Ikbkg)
   04657 IL-17 signaling pathway
    110287188 (Ikbkg)
   04662 B cell receptor signaling pathway
    110287188 (Ikbkg)
   04062 Chemokine signaling pathway
    110287188 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110287188 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110287188 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110287188 (Ikbkg)
   05203 Viral carcinogenesis
    110287188 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110287188 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110287188 (Ikbkg)
   05221 Acute myeloid leukemia
    110287188 (Ikbkg)
   05220 Chronic myeloid leukemia
    110287188 (Ikbkg)
   05215 Prostate cancer
    110287188 (Ikbkg)
   05222 Small cell lung cancer
    110287188 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    110287188 (Ikbkg)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110287188 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110287188 (Ikbkg)
   05135 Yersinia infection
    110287188 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110287188 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    110287188 (Ikbkg)
   05162 Measles
    110287188 (Ikbkg)
   05164 Influenza A
    110287188 (Ikbkg)
   05161 Hepatitis B
    110287188 (Ikbkg)
   05160 Hepatitis C
    110287188 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    110287188 (Ikbkg)
   05163 Human cytomegalovirus infection
    110287188 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110287188 (Ikbkg)
   05169 Epstein-Barr virus infection
    110287188 (Ikbkg)
   05165 Human papillomavirus infection
    110287188 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110287188 (Ikbkg)
   05142 Chagas disease
    110287188 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110287188 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110287188 (Ikbkg)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110287188 (Ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 ERM
Other DBs
NCBI-GeneID: 110287188
NCBI-ProteinID: XP_021009489
Ensembl: MGP_CAROLIEiJ_G0033187
LinkDB
Position
X
AA seq 413 aa
MNKHLWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQ
ALKDLEQLKKCQQVQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQTLDGRIRAISE
QVRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQ
DYDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQAD
IYKADFQAERRAREKLVEKKEYLQEQLEQLQRDFNKLKVGCHESARIEDMRKRHVETSQP
PLLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaacaagcacctctggaagaatcagctgagtgagatggtgcagcccagtggtggccca
gcagaggaccaggacatgctgggtgaagaatcttctctggggaagcctgcaatgctacat
ctgccttcagagcagggtactcctgagaccctccagcgctgtctggaagagaatcaagag
ctccgagacgctatccggcagagcaatcagatgctgagggaacgctgtgaggagctgctg
catttccaggtcagccagcgggaggagaaggagttccttatgtgcaaattccaggaagcc
aggaagctggtggagagactgagcttggagaagcttgatcttcggagtcagagggaacag
gccttaaaggatttggagcaactgaagaaatgccaacaggtacagatggctgaggacaag
gcctctgtgaaagctcaggtgacatcattgctcggagaactccaggagagccagagtcgt
ttggaggctgccaccaaggaacggcaaactttagatggaaggattcgagcaattagtgag
caggtcagacagttggagagtgagcgggaggtgctacagcagcagcacagtgtccaggtg
gaccagctgcgcatgcagaaccagagtgtggaggctgccttgcgaatggagcgacaggct
gcttcagaggagaagcggaagctggctcagttgcaggcagcctatcaccagctcttccaa
gactacgacagccacattaagagcagcaagggcatgcagctggaagatctgaggcaacag
ctccagcaagctgaggaggccctggtagccaaacaggaattgattgataagctgaaagag
gaggctgagcaacacaagattgtgatggagactgtgccagtcttgaaggcccaggcggat
atctacaaggctgacttccaagctgagaggcgtgcccgggagaagctggtggagaagaag
gagtatttgcaggagcagctggagcagctgcagcgcgatttcaacaagctgaaagttggc
tgccatgagtcagccaggattgaggatatgaggaagcggcatgtagagacttcccagcct
cctttactccctgctccagctcaccactcctttcatttggccttgtccaaccagcggagg
agcccccctgaagaacctcctgacttctgttgtcccaagtgccagtatcaggctcctgat
atggacactctacagatacatgtcatggagtgcatagagtag

DBGET integrated database retrieval system