KEGG   Mus caroli (Ryukyu mouse): 110290048
Entry
110290048         CDS       T05910                                 

Gene name
Mmp9
Definition
(RefSeq) matrix metalloproteinase-9 isoform X1
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04915  Estrogen signaling pathway
mcal04926  Relaxin signaling pathway
mcal05161  Hepatitis B
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05215  Prostate cancer
mcal05219  Bladder cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110290048 (Mmp9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    110290048 (Mmp9)
   04670 Leukocyte transendothelial migration
    110290048 (Mmp9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110290048 (Mmp9)
   04926 Relaxin signaling pathway
    110290048 (Mmp9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290048 (Mmp9)
   05202 Transcriptional misregulation in cancer
    110290048 (Mmp9)
   05206 MicroRNAs in cancer
    110290048 (Mmp9)
   05205 Proteoglycans in cancer
    110290048 (Mmp9)
  09162 Cancer: specific types
   05219 Bladder cancer
    110290048 (Mmp9)
   05215 Prostate cancer
    110290048 (Mmp9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110290048 (Mmp9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110290048 (Mmp9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110290048 (Mmp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110290048 (Mmp9)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     110290048 (Mmp9)
Peptidases and inhibitors [BR:mcal01002]
 Metallo peptidases
  Family M10
   110290048 (Mmp9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PT PG_binding_1 Reprolysin_4 Peptidase_M66 DUF4953 Reprolysin_3
Other DBs
NCBI-GeneID: 110290048
NCBI-ProteinID: XP_021012181
Ensembl: MGP_CAROLIEiJ_G0024677
UniProt: A0A6P5PCK5
LinkDB
Position
2
AA seq 730 aa
MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQLAEEYLYRYGYTRAAQ
MMGEEQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHN
ITYWIQNYSEDLPRDVIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRS
YSACTTDGRNDGTPWCSTTADYDTDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYS
ACTTKGRSDGYLWCATTANYDQDKLYGFCPTRVDATVVGGNSAGERCVFPFVFLGKQYSS
CTKEGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTVPPTAYPT
VGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPAGNPCNVDIFD
AIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLIARTWPALPATLDSAFEDPQTKRIFFF
SGRQLWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRPGKALLFSNGHIWRFDLKSQKV
DPQSVIRMDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVG
YVAYGLLQCP
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgagcccctggcagcccctgctcctggctctcctggctttcggctgcagctctgctgcc
ccttaccagcgccagccgacttttgtggtcttccccaaagacctgaaaacctccaacctc
acggacacccagctggcagaggaatacttgtaccgctatggttacactcgggcagcccag
atgatgggggaggagcagtctctacggccggctttgctgatgcttcagaagcagctctcc
ctgccccagactggtgagctggacagccagacactaaaggccattcgaacaccacgctgt
ggtgtcccagatgtgggtcgattccaaaccttcaaaggcctcaagtgggaccatcataac
atcacatactggatccaaaactactctgaagacttgccgcgagacgtgatcgacgacgcc
ttcgcgcgcgccttcgcggtgtggggcgaggtggcaccgctcaccttcacccgcgtgtac
gggcccgaagcggacattgtcatccagtttggtgtcgcagagcacggagacgggtatccc
ttcgacggcaaggacggccttctggcacacgcctttccccctggccccggcgttcaggga
gatgcccatttcgacgacgacgagttgtggtcgctgggcaaaggcgtcgtgatccccact
tactatggaaactcaaatggtgccccatgtcactttcccttcacctttgagggacgctcc
tattcagcctgcaccacagacggccgcaacgacggcacgccttggtgtagcacgacagct
gactacgataccgacggcaaatttggtttctgccctagtgagagactctacacggagcac
ggcaacggagaaggcaaaccctgtgtgttcccgttcatctttgagggtcgctcctactct
gcctgcaccactaaaggccgctcggatggttatctctggtgtgccaccacagccaactat
gaccaggataaactgtatggcttctgccctacccgagtggacgcgaccgtagttgggggc
aactcggcaggagagcggtgcgtcttccccttcgtcttcctgggcaagcagtactcttcc
tgtaccaaagagggccgcagggatgggcgcctctggtgtgcgaccacatccaacttcgac
actgacaagaagtggggtttctgtccagaccaagggtacagcctgttcctggtggcagcg
cacgagttcggccatgcactgggcttagatcattccagcgtgccggaagcgctcatgtac
ccgctgtatagctacctcgagggcttccctctgaataaagacgacatagacggcatccag
tatctgtatggtcgtggctctaagcctgacccaaggcctccagccaccaccacaactgaa
ccacagccgacagcacctcccactatgtgtcccactgtacctcccacggcctatcccaca
gtgggccccacggttggccctacaggcgccccctcacctggccccacgagcagcccctca
cctggccctacaggcgccccctcacctggccctacagcgccccctaccgcgggctcttct
gaggcctctacagagtctttgagtccagcaggcaatccttgcaatgtggatatttttgat
gctattgcagagatccagggcgctctgcatttcttcaaggacggttggtactggaagttc
ctgaatcacagaggaagcccattacagggccccttcctcattgcccgcacgtggccagcc
ctgcctgcaacgctggactcagcctttgaggatccgcagaccaagaggattttcttcttc
tctggacgccaactgtgggtgtacacaggcaagaccgtgctgggccccaggagtctggat
aagttgggtctaggcccagaggtaacccacgtcagcgggcttctcccgcgtcgtcccggg
aaggctctgctgttcagcaacgggcatatctggagattcgacttgaagtctcagaaggtg
gatccccagagcgtcattcgcatggataaggagttctctggtgtgccctggaactcacac
gacatcttccagtaccaagacaaagcctatttctgccatggcaaattcttctggcgtgtg
agtttccaaaatgaggtgaacaaggtggaccatgaggtgaaccaggtggacgacgtgggc
tacgtggcctacggcctcctgcagtgcccttga

KEGG   Mus caroli (Ryukyu mouse): 110301975
Entry
110301975         CDS       T05910                                 

Definition
(RefSeq) stromelysin-1
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal05171  Coronavirus disease - COVID-19
mcal05202  Transcriptional misregulation in cancer
mcal05215  Prostate cancer
mcal05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110301975
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    110301975
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110301975
  09162 Cancer: specific types
   05215 Prostate cancer
    110301975
  09163 Immune disease
   05323 Rheumatoid arthritis
    110301975
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110301975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110301975
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     110301975
Peptidases and inhibitors [BR:mcal01002]
 Metallo peptidases
  Family M10
   110301975
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin DUF4953 Reprolysin_5 Reprolysin_4 Reprolysin_3 Peptidase_M66
Other DBs
NCBI-GeneID: 110301975
NCBI-ProteinID: XP_021028370
Ensembl: MGP_CAROLIEiJ_G0031752
UniProt: A0A6P5QDR3
LinkDB
Position
9
AA seq 477 aa
MKGLPVLLWLCVVVCSSYPLHDSARDDDASMELLQKYLENYYGLEKDVKQFIKKKDSSLI
VKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRIVN
YTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFVPFDGPGTV
LAHAYAPGPGINGDAHFDDDERWTEDVTGTNLFLVAAHELGHSLGLFHSAKAEALMYPVY
KSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLVVPTKSNSLEPETSPMCSSTLFFDAVS
TLRGEVLFFKDRHFWRKSLRTPEPGFYLISSFWPSLPSNIDAAYEVTNRDTVFIFKGNQF
WAIRGHEELAGYPKSIHTLGLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSMEP
GFPRKIAEDFPGVESRVDAVFEAFGFLYFFSGSSQLEFDPNAKKVTHILKSNSWFNC
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgaagggtcttccggtcctgctgtggctgtgtgtggttgtatgctcgtcctacccattg
catgacagtgcaagggatgatgatgctagtatggagcttctgcagaaatacctagaaaac
tactatggccttgaaaaagatgtgaaacaatttattaagaaaaaggacagtagtcttatt
gtcaaaaaaattcaagaaatgcagaagttcctcgggttggagatgacagggaagctggac
tccaacactatggagctgatgcacaagcccaggtgtggtgttcctgatgttggtggcttc
agtaccttcccaggttcgccaaaatggaggaaatcccacatcacctacaggattgtgaat
tacacaccagatttgccaagacagagtgtggattctgccattgagaaagctttgaaggtc
tgggaggaggtgaccccactcactttctccaggatctctgaaggagaggctgacataatg
atctcctttgcagttggagaacatggagactttgtcccttttgatgggcctggaacagtc
ttggctcatgcctatgcacctggaccagggattaatggagatgctcactttgacgatgat
gaacggtggacagaggatgtcactggtaccaacctattcctggttgccgctcatgaactt
ggccactccctgggtctctttcactcagccaaggctgaagctctgatgtacccagtctac
aagtcctccacagacttgtcccgtttccatctctctcaagacgatgtagatggtattcag
tccctctatggaactcccacagcatcccctgatgtcctcgtggtacccaccaagtctaat
tctctggaacctgagacatcaccaatgtgcagctctactttgttctttgatgcagtcagc
accctccggggagaagtcctgttttttaaagacaggcacttttggcgcaaatctctcagg
actcctgagcctggattttatttgatctcttcattttggccgtcccttccgtccaacata
gatgctgcatatgaggttactaacagagacactgttttcatttttaaaggaaatcagttc
tgggctatacgagggcacgaggagctagcaggttatcctaaaagcattcacaccctgggt
ctccctgcaaccgtgaagaagatcgatgctgccatttctaataaagagaaaaggaagacc
tacttctttgtagaggacaaatactggaggtttgatgagaagaaacaatccatggagcca
ggatttcccaggaagatagctgaggactttccaggtgttgaatcaagggtggatgctgtc
tttgaagcatttgggtttctctacttcttcagtggatcttcacagttggaatttgaccca
aatgccaaaaaagtgacccacatattgaagagcaatagctggtttaattgttaa

DBGET integrated database retrieval system