KEGG   Mus caroli (Ryukyu mouse): 110298222
Entry
110298222         CDS       T05910                                 

Gene name
Fadd
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05142  Chagas disease
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110298222 (Fadd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110298222 (Fadd)
   04215 Apoptosis - multiple species
    110298222 (Fadd)
   04217 Necroptosis
    110298222 (Fadd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110298222 (Fadd)
   04621 NOD-like receptor signaling pathway
    110298222 (Fadd)
   04622 RIG-I-like receptor signaling pathway
    110298222 (Fadd)
   04657 IL-17 signaling pathway
    110298222 (Fadd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298222 (Fadd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110298222 (Fadd)
   05022 Pathways of neurodegeneration - multiple diseases
    110298222 (Fadd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110298222 (Fadd)
   05152 Tuberculosis
    110298222 (Fadd)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110298222 (Fadd)
   05161 Hepatitis B
    110298222 (Fadd)
   05160 Hepatitis C
    110298222 (Fadd)
   05164 Influenza A
    110298222 (Fadd)
   05162 Measles
    110298222 (Fadd)
   05168 Herpes simplex virus 1 infection
    110298222 (Fadd)
   05163 Human cytomegalovirus infection
    110298222 (Fadd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110298222 (Fadd)
   05169 Epstein-Barr virus infection
    110298222 (Fadd)
   05165 Human papillomavirus infection
    110298222 (Fadd)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110298222 (Fadd)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110298222 (Fadd)
SSDB
Motif
Pfam: DED Death
Other DBs
NCBI-GeneID: 110298222
NCBI-ProteinID: XP_021022996
Ensembl: MGP_CAROLIEiJ_G0030755
UniProt: A0A6P5Q174
LinkDB
Position
7
AA seq 205 aa
MDPFLVLLHSLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFTVLLEQNDLERGRT
GLLRELLASLRRHDLLQRLDDFEAGTATAAPPGEADLQVAFDIVCDNVGRDWKALARELK
VSEAKIDGIEEKYPRSLSERIRESLKVWKNAEKKNASVARLVKALRTCRLNLVADLVEEA
QESVSKSEDMSPVLRDSTVSSSETP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggacccattcctggtgctgctgcactcgctgtccggcagcctgtcgggcaacgatctg
atggagctcaagttcttgtgccgcgagcgcgtgagcaaacgaaagctggagcgcgtgcag
agtggcctggacctgttcacggtgctgctggagcagaacgacttggagcgcgggcgaacc
gggctgctgcgcgagttgctggcctcgttgcgccgacacgatctactgcagcgcctggac
gacttcgaggcggggacggcgaccgctgcgcccccgggggaggcagatctgcaggtggca
tttgacattgtgtgtgacaatgtggggagagactggaaagcactggcccgagagctgaag
gtgtctgaggccaagattgatgggattgaggagaagtacccccgaagtctgagtgagcgg
ataagggagagtctgaaagtctggaagaatgccgagaagaagaacgcctcggtggccaga
ctggtcaaggcgctgcggacctgcaggctgaatctggtggctgacctggtggaagaagcc
caggaatctgtgagcaagagtgaggatatgtccccagtgctaagggattcaactgtgtct
tcctcagaaacaccctga

DBGET integrated database retrieval system