KEGG   Mus caroli (Ryukyu mouse): 110301054
Entry
110301054         CDS       T05910                                 

Gene name
Ldlr
Definition
(RefSeq) low-density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04913  Ovarian steroidogenesis
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04934  Cushing syndrome
mcal04976  Bile secretion
mcal04979  Cholesterol metabolism
mcal05145  Toxoplasmosis
mcal05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110301054 (Ldlr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110301054 (Ldlr)
   04925 Aldosterone synthesis and secretion
    110301054 (Ldlr)
   04927 Cortisol synthesis and secretion
    110301054 (Ldlr)
  09154 Digestive system
   04976 Bile secretion
    110301054 (Ldlr)
   04979 Cholesterol metabolism
    110301054 (Ldlr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110301054 (Ldlr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110301054 (Ldlr)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110301054 (Ldlr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110301054 (Ldlr)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110301054 (Ldlr)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL hEGF
Other DBs
NCBI-GeneID: 110301054
NCBI-ProteinID: XP_021026939
Ensembl: MGP_CAROLIEiJ_G0031880
UniProt: A0A6P5QA77
LinkDB
Position
9
AA seq 861 aa
MSTADLMCRWVIALLLAAAGVAAEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESP
ETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSLDDFRCQDGK
CISPQFVCDGDRDCLDGSDEAHCKATTCGPAHFRCNSSTCIPSLWACDGDGDCDDGSDEW
PQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPD
EFQCADGSCIHGSRQCDREHDCKDMSDELGCVNVTQCDGPNKFKCHSGECISLDKVCDSA
RDCRDWSDEPIKECETNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDLHRCEDIDECQ
EPDTCSQLCVNLEGSYKCECRAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEY
TSLLPNLKNVVALDTEVTNNRIYWSDLSQKKIYSALMDQAPNLSYDTIISEDLHAPDGLA
VDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILE
DENQLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGADVNLVAENLLSPEDIVLFHNVTQ
PRGVNWCETTALPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSCLTEVDTVPT
TQGTSAVGPVVTESAARPPKHNEDLSAPSTPRQPVDTPGLSTVASVTVSHQVQGDMAGRG
HEEQPRGVRFLSIFFPIALVALLVLGAVLLWRNWRLKNINSINFDNPVYQKTTEDELHIC
RSQDGYTYPSRQMVSLEDDVA
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgagcaccgcggatctgatgtgtcgctgggtcatcgccctgctcctggctgctgccgga
gttgcagcagaagactcatgcagcaggaacgagttccagtgtagagacggaaaatgcatc
gctagcaagtgggtgtgtgacggcagccccgagtgcccagatggctctgatgagtcccca
gagacatgcatgtctgtcacctgtcagtccaatcaattcagctgtggaggccgtgtcagc
cgatgcattcctgactcctggagatgtgatggacaggtagactgtgaaaatgactcagac
gaacaaggctgtccccccaagacgtgctccctggatgacttccgctgccaggatggcaag
tgcatctccccgcagtttgtgtgtgatggagaccgagattgcctggacggctctgatgag
gcccactgcaaggccaccacttgtggccccgcccacttccgctgcaactcatccacatgc
atccccagcctttgggcctgcgacggggatggcgactgtgatgacggctccgatgagtgg
ccacagaactgccagggccgagacacggcctccaaaggggttagcagcccctgctcctcc
ctggagttccactgtggtagtagtgagtgtatccatcgcagctgggtctgtgacggcgag
gcagactgcaaggacaagtcagacgaggagcactgcgcggtggccacctgccgacctgat
gaattccagtgtgcagatggctcctgcattcacggtagccgccagtgtgaccgtgaacat
gactgcaaggacatgagcgacgagcttggctgcgtcaatgtgacacagtgtgatggcccc
aacaagttcaagtgtcacagtggggagtgcatcagcttggacaaggtgtgcgactctgcc
cgggactgccgggactggtcggatgagcccatcaaggagtgcgagaccaacgagtgtttg
gacaacaatggtggctgttcccacatctgcaaggacctcaagataggctctgagtgcctg
tgtcccagtggcttccggctggtggacctccacaggtgtgaagatattgacgagtgtcag
gagccagacacctgcagccagctctgtgtgaacctggaaggcagctacaagtgtgagtgc
cgggccggcttccacatggacccacacaccagggtctgcaaggctgtgggctccataggc
tatctgctcttcaccaaccgccacgaggtccggaagatgaccctggaccgcagcgagtac
accagtctgctccccaacctgaagaatgtggtggctctcgacactgaggtgaccaacaat
agaatctactggtccgacctgtcccaaaaaaagatctacagcgccctgatggaccaggcc
cctaacttgtcctacgacaccatcatcagtgaggacctgcatgcccctgacgggctggcg
gtagactggatccaccgcaacatctactggacagattcagtcccaggcagtgtgtctgtg
gccgacaccaagggcgtaaagaggaggacactgttccaagaggcagggtccagacccaga
gccatcgtagtggaccctgtgcatggcttcatgtactggacagattggggaacacccgcc
aagatcaagaaagggggtttgaatggtgtggacatccactcactggtgaccgaaaacatc
cagtggccaaatggcatcacactagatctttccagtggccgtctctattgggttgattcc
aaactccactctatctccagcattgatgtcaatgggggcaatcggaaaaccattttggag
gatgagaaccagctggcccaccccttctccttggccatctatgaggacaaagtatattgg
acagatgtcataaacgaagccattttcagtgccaatcgactcacgggtgcagatgtgaat
ttggtggctgaaaacctcttgtccccagaggacattgtcttgttccacaacgtcacacag
cctagaggggtgaactggtgtgagacaacagccctccccaatggtggttgccagtacctg
tgcctgcccgccccacagatcggtccccactcgcccaaattcacctgtgcctgccctgat
ggcatgctgctggccaaggacatgcggagctgcctcacagaagtcgacactgtaccgacc
acccaggggacatccgccgtcgggcctgtggtcaccgaatcagctgccaggccaccgaag
cacaatgaggatctctcagctcccagtactcctaggcagcctgtggacaccccagggctc
agcacagtggcgtcagtgacagtgtcccaccaagtccagggtgacatggctggcagaggg
catgaggagcagccacgtggtgtgaggttcctgtccatcttcttccctattgcactggtt
gccctccttgtccttggggctgtcctactgtggaggaactggcggctgaagaacatcaac
agcataaactttgacaacccagtctaccagaagaccacagaggacgaactccacatttgc
cgaagccaggacggctatacctacccctcaagacagatggtcagcctggaggacgatgtg
gcgtga

DBGET integrated database retrieval system