Mus pahari (shrew mouse): 110315179 Help Entry 110315179         CDS       T05929                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04151   PI3K-Akt signaling pathway mpah04217   Necroptosis mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04936   Alcoholic liver disease mpah05152   Tuberculosis mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05165   Human papillomavirus infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05320   Autoimmune thyroid disease mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110315179    04151 PI3K-Akt signaling pathway     110315179   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110315179  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110315179  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110315179    04621 NOD-like receptor signaling pathway     110315179    04622 RIG-I-like receptor signaling pathway     110315179    04623 Cytosolic DNA-sensing pathway     110315179    04650 Natural killer cell mediated cytotoxicity     110315179  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110315179   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110315179    05161 Hepatitis B     110315179    05160 Hepatitis C     110315179    05171 Coronavirus disease - COVID-19     110315179    05164 Influenza A     110315179    05162 Measles     110315179    05168 Herpes simplex virus 1 infection     110315179    05163 Human cytomegalovirus infection     110315179    05167 Kaposi sarcoma-associated herpesvirus infection     110315179    05169 Epstein-Barr virus infection     110315179    05165 Human papillomavirus infection     110315179   09171 Infectious disease: bacterial    05152 Tuberculosis     110315179   09163 Immune disease    05320 Autoimmune thyroid disease     110315179   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110315179   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110315179  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110315179 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interferons    110315179 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon STX6_10_61_N Motif Other DBs NCBI-GeneID:  110315179 NCBI-ProteinID:  XP_021044962 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MARLCAFLVILIVMSYWSACSLGCHLPHTSNLRNKRALTLLEQLRRLPPLSCLKDRKDFG FHLENVDAQQVQKAQAILVLRDLTQQILNLFTRKDSSATWNATLLDSFCNDLHQQLNDLK ACVMQEVVVQEPPLIQEDSLAVRIYFHRISVYLRKKKHSPCAWEVVRAEVWRALSSSAKL LARLSKEEE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggctaggctctgtgctttccttgtgatcctgatagtgatgagctactggtcagcgtgt tctctaggatgtcacctgcctcacacttctaacctcaggaacaagagggccttgacactc ctggaacaactgagaagactcccccctctttcctgcctgaaggacaggaaggactttgga ttccatttggagaatgtggatgcccaacaggtccagaaggctcaagccatccttgtgctg agagaccttacccagcagatcttgaacctcttcacaagaaaggactcatctgctacttgg aatgcaactctcctagactccttctgcaatgacctccaccagcagctcaacgacctcaaa gcctgtgtgatgcaggaggttgtggtgcaggaacctcccctgatccaggaagactccctg gctgtgagaatatacttccacaggatctctgtgtacctgagaaagaagaaacacagcccc tgtgcctgggaagtggtcagagcagaagtctggagagccctgtcttcctcagccaagctg ctggcaagactgagtaaggaggaggagtga

Mus pahari (shrew mouse): 110315688 Help Entry 110315688         CDS       T05929                                  Name (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04151   PI3K-Akt signaling pathway mpah04217   Necroptosis mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04936   Alcoholic liver disease mpah05152   Tuberculosis mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05165   Human papillomavirus infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05320   Autoimmune thyroid disease mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110315688    04151 PI3K-Akt signaling pathway     110315688   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110315688  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110315688  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110315688    04621 NOD-like receptor signaling pathway     110315688    04622 RIG-I-like receptor signaling pathway     110315688    04623 Cytosolic DNA-sensing pathway     110315688    04650 Natural killer cell mediated cytotoxicity     110315688  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110315688   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110315688    05161 Hepatitis B     110315688    05160 Hepatitis C     110315688    05171 Coronavirus disease - COVID-19     110315688    05164 Influenza A     110315688    05162 Measles     110315688    05168 Herpes simplex virus 1 infection     110315688    05163 Human cytomegalovirus infection     110315688    05167 Kaposi sarcoma-associated herpesvirus infection     110315688    05169 Epstein-Barr virus infection     110315688    05165 Human papillomavirus infection     110315688   09171 Infectious disease: bacterial    05152 Tuberculosis     110315688   09163 Immune disease    05320 Autoimmune thyroid disease     110315688   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110315688   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110315688  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110315688 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interferons    110315688 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  110315688 NCBI-ProteinID:  XP_021045340 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MARLCAFLVILIVMSHWSACSLGCDLPHTFNLRNKRALTLLEQLRRLPPLSCLKDRKDFG LPLEKVDTQHVQKAQAILVLRDLTQQILNLFTTKASSAAWNATLLDSFCNDLHQQLNDLK ACVMQEVVGQEPPLTQEDSLMAVRIYFHRITVYLRKKKHSPCAWEVVRVEVWRALSSSAK LLARLSEE NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggcaaggctctgtgctttcctcgtgatcctgatagtgatgagccactggtcagcgtgt tctctaggatgtgacctgcctcacactttcaacctcaggaacaagagggccttgacactc ctggaacaactgagaagactcccccctctttcctgcctgaaggacaggaaggactttgga ttgcctttggagaaggtggatacccaacatgtccagaaggctcaagccatccttgtgctg agagatcttacccagcagatcttgaacctcttcacaacaaaggcttcatcagctgcttgg aatgcaactctcctagactccttctgcaatgacctccatcagcagctcaatgacctcaaa gcctgtgtgatgcaggaggttgtgggacaggaacctcctctgacccaggaagactccctg atggctgtgagaatatacttccacaggatcactgtgtaccttagaaagaagaaacacagc ccctgtgcctgggaggtggtcagagtagaagtctggagagccctgtcttcctcagccaag ctgctggcaagactgagtgaggagtaa

Mus pahari (shrew mouse): 110317140 Help Entry 110317140         CDS       T05929                                  Symbol Il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism mpah  Mus pahari (shrew mouse) Pathway mpah01521   EGFR tyrosine kinase inhibitor resistance mpah01523   Antifolate resistance mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04066   HIF-1 signaling pathway mpah04068   FoxO signaling pathway mpah04151   PI3K-Akt signaling pathway mpah04218   Cellular senescence mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04625   C-type lectin receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04640   Hematopoietic cell lineage mpah04657   IL-17 signaling pathway mpah04659   Th17 cell differentiation mpah04668   TNF signaling pathway mpah04672   Intestinal immune network for IgA production mpah04931   Insulin resistance mpah04932   Non-alcoholic fatty liver disease mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04936   Alcoholic liver disease mpah05010   Alzheimer disease mpah05020   Prion disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05132   Salmonella infection mpah05133   Pertussis mpah05134   Legionellosis mpah05135   Yersinia infection mpah05142   Chagas disease mpah05143   African trypanosomiasis mpah05144   Malaria mpah05146   Amoebiasis mpah05152   Tuberculosis mpah05161   Hepatitis B mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05202   Transcriptional misregulation in cancer mpah05321   Inflammatory bowel disease mpah05323   Rheumatoid arthritis mpah05332   Graft-versus-host disease mpah05410   Hypertrophic cardiomyopathy mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110317140 (Il6)    04668 TNF signaling pathway     110317140 (Il6)    04066 HIF-1 signaling pathway     110317140 (Il6)    04068 FoxO signaling pathway     110317140 (Il6)    04151 PI3K-Akt signaling pathway     110317140 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110317140 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     110317140 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     110317140 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110317140 (Il6)    04620 Toll-like receptor signaling pathway     110317140 (Il6)    04621 NOD-like receptor signaling pathway     110317140 (Il6)    04623 Cytosolic DNA-sensing pathway     110317140 (Il6)    04625 C-type lectin receptor signaling pathway     110317140 (Il6)    04659 Th17 cell differentiation     110317140 (Il6)    04657 IL-17 signaling pathway     110317140 (Il6)    04672 Intestinal immune network for IgA production     110317140 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110317140 (Il6)    05202 Transcriptional misregulation in cancer     110317140 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110317140 (Il6)    05161 Hepatitis B     110317140 (Il6)    05171 Coronavirus disease - COVID-19     110317140 (Il6)    05164 Influenza A     110317140 (Il6)    05162 Measles     110317140 (Il6)    05168 Herpes simplex virus 1 infection     110317140 (Il6)    05163 Human cytomegalovirus infection     110317140 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     110317140 (Il6)    05169 Epstein-Barr virus infection     110317140 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     110317140 (Il6)    05135 Yersinia infection     110317140 (Il6)    05133 Pertussis     110317140 (Il6)    05134 Legionellosis     110317140 (Il6)    05152 Tuberculosis     110317140 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     110317140 (Il6)    05144 Malaria     110317140 (Il6)    05142 Chagas disease     110317140 (Il6)    05143 African trypanosomiasis     110317140 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     110317140 (Il6)    05321 Inflammatory bowel disease     110317140 (Il6)    05332 Graft-versus-host disease     110317140 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     110317140 (Il6)    05020 Prion disease     110317140 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     110317140 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110317140 (Il6)    05410 Hypertrophic cardiomyopathy     110317140 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110317140 (Il6)    04932 Non-alcoholic fatty liver disease     110317140 (Il6)    04931 Insulin resistance     110317140 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     110317140 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110317140 (Il6)    01523 Antifolate resistance     110317140 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110317140 (Il6) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110317140 (Il6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 Motif Other DBs NCBI-GeneID:  110317140 NCBI-ProteinID:  XP_021047197 Ensembl:  MGP_PahariEiJ_G0021821 LinkDB All DBs Position 2:24245342..24252239 Genome browser AA seq 211 aa AA seqDB search MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITQVLR EILAMRKELCNGNPDCMNNDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKITSGLLEY QIYLEYMKNNLKDNKKDKARVIQRDTETLIYIFNQEVKDLYKIVLPSPISDPLLMEKMES QKEWLRTKTIQFILKALEEFLKVTLRSTRQT NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgaagttcctctctgcaagagacttccatccagttgccttcttgggactgatgctggtg acaaccacggccttccctacttcacaagtccggagaggagacttcacagaggacaccact cccaacagaccagtatacaccacttcacaagtcggaggcttaattacacaagttctcagg gaaatcttggcaatgagaaaagagttgtgcaatggcaatcctgattgtatgaacaacgat gatgcactttcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgcttc caaactggatacaatcaggaaatttgcctattgaaaattacctctggtcttctggagtac caaatctacctggagtacatgaagaacaacttaaaagataacaagaaagacaaagccaga gtcattcagagagatacagaaaccctaatttatatcttcaatcaagaggtaaaagattta tataaaatagtccttcctagcccaatttccgatcctctcctaatggagaagatggagtca cagaaggagtggctaaggaccaagaccatccaattcatcttgaaagcacttgaagaattt ctaaaagtcactttgagatctactcggcaaacctag

Mus pahari (shrew mouse): 110317734 Help Entry 110317734         CDS       T05929                                  Name (RefSeq) cardiotrophin-2   KO K24382   cardiotrophin 2 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110317734   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110317734  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110317734 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   CSF and other factors    110317734 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PRF CNTF LIF_OSM IL11 EPO_TPO Motif Other DBs NCBI-GeneID:  110317734 NCBI-ProteinID:  XP_021048076 Ensembl:  MGP_PahariEiJ_G0013723 LinkDB All DBs Position 1:complement(97199515..97207049) Genome browser AA seq 204 aa AA seqDB search MYCLLATPLCLLSLLLPPLSPAAPISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPF SDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRVQGAFLALTQHLQLVGDDQSYLNP GSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGLVPFGASAFERKCRGYIV TREYGHWTDRAVRDLALLKAKYPA NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgtactgcctgctggcaactcccctatgcctactgagcctgctgttgccacccctcagt cctgcggcccccatctccccatcagagcccatcggtcaagcctacagcctggctctctac atgcagaagaacacgtcagcattgctacagacctatctccagcaccagggcagccccttc agcgaccccggcttctcagctcccgagctccagctcagcaccctgccttctgcagctgtc tccttcaagacctggcatgcaatggaagatgcagagcggctaagccgagtccagggagcc tttctggccttgacccagcacctccagctcgtgggggacgaccagagttatctgaatcct ggcagtcctatcctgctggcccagctaggagcagcaagactcagggcccaaggcctattg ggcaacatggctgctatcatgacggctctagggctgcccatccctccagaagaggatact ctggggcttgtcccttttggggcctcagcctttgaaaggaaatgcagaggctacatagtg acccgagaatatggtcactggacagacagggctgtgagggacttggctctccttaaggct aagtacccagcatag

Mus pahari (shrew mouse): 110317740 Help Entry 110317740         CDS       T05929                                  Symbol Ctf1 Name (RefSeq) cardiotrophin-1 isoform X1   KO K05422   cardiotrophin 1 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110317740 (Ctf1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110317740 (Ctf1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110317740 (Ctf1) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   CSF and other factors    110317740 (Ctf1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LIF_OSM PRF Motif Other DBs NCBI-GeneID:  110317740 NCBI-ProteinID:  XP_021048090 Ensembl:  MGP_PahariEiJ_G0013722 LinkDB All DBs Position 1:97193345..97198195 Genome browser AA seq 203 aa AA seqDB search MSQREGSLEDHQSGSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPG FSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLR SLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVC GLYGEWVSRTEGDLGQLVPGGVA NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgagccagagggagggaagtctggaagaccaccagtctggctcctcaatctcattccta ccccatttggaggccaagatccgccagacacacaaccttgcccgcctcctgaccaaatat gcagaacaactgctggaagaatacgtgcagcaacagggagagccctttgggctgccgggc ttctcaccaccgcggctgccgctggccggcctgagtggcccggctccgagccatgcaggg ctaccggtgtctgagcggctgcggcaggatgcagccgccctgagtgtgctgcccgcgctg ttggatgcggtccgccgccgccaggcggagctgaacccgcgcgccccgcgcctgctgcgg agcctggaggacgcggcccgccaggttcgggccctgggcgccgcggtggagacggtgctg gccgctctgggcgctgcagcccgcgggcccgggccagagcccgtcaccgtcgccaccctc ttcacggccaacagcactgcaggcatcttctcagccaaggtgctggggttccacgtgtgc ggcctctatggcgagtgggtgagccgcaccgagggcgacctgggccagctggtgccaggg ggcgtcgcctga

Mus pahari (shrew mouse): 110320556 Help Entry 110320556         CDS       T05929                                  Symbol Il2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04151   PI3K-Akt signaling pathway mpah04625   C-type lectin receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04659   Th17 cell differentiation mpah04660   T cell receptor signaling pathway mpah04672   Intestinal immune network for IgA production mpah04940   Type I diabetes mellitus mpah05135   Yersinia infection mpah05142   Chagas disease mpah05162   Measles mpah05166   Human T-cell leukemia virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05320   Autoimmune thyroid disease mpah05321   Inflammatory bowel disease mpah05330   Allograft rejection mpah05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110320556 (Il2)    04151 PI3K-Akt signaling pathway     110320556 (Il2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110320556 (Il2)    04061 Viral protein interaction with cytokine and cytokine receptor     110320556 (Il2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110320556 (Il2)    04660 T cell receptor signaling pathway     110320556 (Il2)    04658 Th1 and Th2 cell differentiation     110320556 (Il2)    04659 Th17 cell differentiation     110320556 (Il2)    04672 Intestinal immune network for IgA production     110320556 (Il2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110320556 (Il2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110320556 (Il2)    05171 Coronavirus disease - COVID-19     110320556 (Il2)    05162 Measles     110320556 (Il2)   09171 Infectious disease: bacterial    05135 Yersinia infection     110320556 (Il2)   09174 Infectious disease: parasitic    05142 Chagas disease     110320556 (Il2)   09163 Immune disease    05320 Autoimmune thyroid disease     110320556 (Il2)    05321 Inflammatory bowel disease     110320556 (Il2)    05330 Allograft rejection     110320556 (Il2)    05332 Graft-versus-host disease     110320556 (Il2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     110320556 (Il2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110320556 (Il2)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110320556 (Il2) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110320556 (Il2) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110320556 (Il2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Rx_N CDK5RAP3 Ribonuc_P_40 DUF7288 Motif Other DBs NCBI-GeneID:  110320556 NCBI-ProteinID:  XP_021052288 Ensembl:  MGP_PahariEiJ_G0026385 LinkDB All DBs Position 4:complement(31532587..31537746) Genome browser AA seq 166 aa AA seqDB search MYSMQLASCVALTLVFLVNSAPTSSPTSSSTSSSTAEAQQQQQHLEQLLMDLQELLSRME NYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGALQRVLDLTQSKSFQLEDAENFISN IRVTVIKLKGSENTLECQFADESVTVVEFLRRWIAFCQSIISARPQ NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgtacagcatgcagctcgcatcctgtgtcgcactgacacttgtgttccttgtcaacagt gcacccacttcaagccccacttcaagttccacttcaagctctacagcggaagcacagcag cagcagcagcacctggagcagctgttgatggacctacaggagctcttgagcaggatggag aattacaggaacctgaaactccccaggatgctcaccttcaaattttacttgcccaagcag gccacagaattgaaagatcttcagtgcctagaagatgaactcggagctctgcagcgtgtg ctggatttgactcaaagcaaaagctttcaattggaagatgctgagaatttcatcagtaat atcagagtaactgttataaaactaaagggctctgaaaacacacttgagtgccaatttgct gatgagtcagtgactgtggtggaatttctgaggagatggatagccttctgtcaaagcatc atctcagcaaggcctcaataa

Mus pahari (shrew mouse): 110320680 Help Entry 110320680         CDS       T05929                                  Symbol Il12a Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04620   Toll-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04625   C-type lectin receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04936   Alcoholic liver disease mpah04940   Type I diabetes mellitus mpah05133   Pertussis mpah05134   Legionellosis mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05143   African trypanosomiasis mpah05144   Malaria mpah05145   Toxoplasmosis mpah05146   Amoebiasis mpah05152   Tuberculosis mpah05162   Measles mpah05164   Influenza A mpah05168   Herpes simplex virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05321   Inflammatory bowel disease mpah05330   Allograft rejection mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110320680 (Il12a)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110320680 (Il12a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110320680 (Il12a)    04622 RIG-I-like receptor signaling pathway     110320680 (Il12a)    04625 C-type lectin receptor signaling pathway     110320680 (Il12a)    04658 Th1 and Th2 cell differentiation     110320680 (Il12a)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110320680 (Il12a)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110320680 (Il12a)    05164 Influenza A     110320680 (Il12a)    05162 Measles     110320680 (Il12a)    05168 Herpes simplex virus 1 infection     110320680 (Il12a)   09171 Infectious disease: bacterial    05133 Pertussis     110320680 (Il12a)    05134 Legionellosis     110320680 (Il12a)    05152 Tuberculosis     110320680 (Il12a)   09174 Infectious disease: parasitic    05146 Amoebiasis     110320680 (Il12a)    05144 Malaria     110320680 (Il12a)    05145 Toxoplasmosis     110320680 (Il12a)    05140 Leishmaniasis     110320680 (Il12a)    05142 Chagas disease     110320680 (Il12a)    05143 African trypanosomiasis     110320680 (Il12a)   09163 Immune disease    05321 Inflammatory bowel disease     110320680 (Il12a)    05330 Allograft rejection     110320680 (Il12a)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110320680 (Il12a)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     110320680 (Il12a)    04936 Alcoholic liver disease     110320680 (Il12a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110320680 (Il12a)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110320680 (Il12a) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110320680 (Il12a) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110320680 (Il12a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 DUF2564 Motif Other DBs NCBI-GeneID:  110320680 NCBI-ProteinID:  XP_021052456 Ensembl:  MGP_PahariEiJ_G0026502 LinkDB All DBs Position 4:60826610..60834361 Genome browser AA seq 236 aa AA seqDB search MVNVPTASPSASSSSSQCRSSMCQSRYLLFLATLAFLNYLSLARVIPVSGPARCLSQSQN LLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDKTSTLETCLPLELHKNESCLATRDAS STTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKSMLVAI DELMQSLNHNGETQRQNPPVGVADPYRVKMKLCILLHAFSTRVVTINRVMSYLSSS NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atggtcaatgttccaaccgcctcaccctcggcatccagcagctcctctcagtgccggtcc agcatgtgtcaatcacgctacctcctctttttggccacccttgccttcctaaactacctc agtttggccagggtcattccagtctctggacctgccaggtgtcttagccagtcccaaaat ctgctgaagaccacagatgacatggtgaagacggccagagaaaaactgaaacattattcc tgcactgctgaagacatcgatcatgaagacatcacacgggacaaaaccagcacactggag acctgtttaccactggaactacacaagaacgagagttgcctggctactagagatgcttct tccacaacaagagggagctgcctgcccccacagaagacttctttgatgatgaccctgtgc cttggtagcatctatgaggacttgaagatgtaccagacagagttccaggccataaatgca gcacttcagaatcacaatcatcagcagatcattctggacaaaagcatgctggtagctatt gatgagctgatgcagtctctgaatcataacggcgagactcagcgccagaacccccccgtg ggagtagcagatccttacagagtgaaaatgaagctctgcatcctgctccatgccttcagc acccgagtggtgaccatcaacagggtgatgagctacctgagctcttcctga

Mus pahari (shrew mouse): 110320935 Help Entry 110320935         CDS       T05929                                  Symbol Il21 Name (RefSeq) interleukin-21 isoform X1   KO K05434   interleukin 21 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04630   JAK-STAT signaling pathway mpah04659   Th17 cell differentiation mpah05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110320935 (Il21)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110320935 (Il21)  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     110320935 (Il21)  09160 Human Diseases   09163 Immune disease    05321 Inflammatory bowel disease     110320935 (Il21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110320935 (Il21) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110320935 (Il21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL15 Motif Other DBs NCBI-GeneID:  110320935 NCBI-ProteinID:  XP_021052672 Ensembl:  MGP_PahariEiJ_G0026386 LinkDB All DBs Position 4:complement(31629226..31638385) Genome browser AA seq 162 aa AA seqDB search MERTLVCLVVIFLGTVAHKSSPQGPDRLLIRLHHLIDIVEQLKIYENDLDPELLSAPQDV KVHCEHAAFACFQKATLKPSNPGNNKTFIGDLVAQLRRRLPARRRGKKQKHITKCPSCDS YEKRTPKEFLERLKWLLQKVRTLNAFLSLPCCPRVPLVPSDS NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggagaggacccttgtctgtctggtagtcatcttcttggggacagtggcccataaatca agcccccaagggccagatcgcctcctgattagacttcatcaccttatagacattgttgaa cagctgaaaatctatgaaaatgacttggatcctgaacttctatcagctccacaagatgta aaggtgcactgtgagcatgcagcttttgcctgttttcagaaggccacactcaagccatca aaccctggaaacaataagacattcatcggtgacttggtggcacagctgaggaggaggctg cctgccaggaggcgaggaaagaaacagaagcacataactaaatgcccatcctgtgattcg tatgagaaaagaacacccaaggaattcctagaaagactaaaatggctccttcaaaaggta cgcaccttaaatgcatttctttcacttccatgttgtccccgggtacctcttgtgcccagt gactcatag

Mus pahari (shrew mouse): 110321006 Help Entry 110321006         CDS       T05929                                  Symbol Il7 Name (RefSeq) interleukin-7 isoform X1   KO K05431   interleukin 7 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04151   PI3K-Akt signaling pathway mpah04630   JAK-STAT signaling pathway mpah04640   Hematopoietic cell lineage mpah05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110321006 (Il7)    04151 PI3K-Akt signaling pathway     110321006 (Il7)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110321006 (Il7)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110321006 (Il7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110321006 (Il7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110321006 (Il7)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110321006 (Il7) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110321006 (Il7) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110321006 (Il7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL7 Motif Other DBs NCBI-GeneID:  110321006 NCBI-ProteinID:  XP_021052746 Ensembl:  MGP_PahariEiJ_G0026278 LinkDB All DBs Position 4:complement(3721535..3762140) Genome browser AA seq 156 aa AA seqDB search MFHVSFRYIFGIPPLILVLLPATSSECHIKDKEGKAYESVLMISIDELVRDKMTGTDSNC LNNEPNFFKKHLCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLRVSQGTQTLVNCTS KEEKNVKEQKRNDACFLKRLLREIKTCWNKILKGSI NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgttccatgtttcttttagatatatctttggaattcctccactgatccttgttctgctg cctgccacgtcatctgagtgccacattaaagacaaagaaggtaaagcatatgagagtgtg ctgatgatcagcatcgatgaattggtacgtgacaaaatgacaggaactgatagcaattgc ctgaataatgaaccaaacttttttaaaaaacatctatgtgatgatacaaaggaagctgct tttctaaatcgtgctgctcgcaagttgaagcaatttcttaaaatgaatatcagtgaagaa ttcaatgtccacttactgagagtgtcacaaggcacacaaacactggtgaactgcacaagt aaggaagaaaaaaacgtaaaggaacagaaaaggaatgatgcatgtttcctaaagagacta ctgagagagataaaaacttgttggaataaaattttgaagggcagtatatga

Mus pahari (shrew mouse): 110322491 Help Entry 110322491         CDS       T05929                                  Symbol Il20 Name (RefSeq) interleukin-20 isoform X1   KO K22667   interleukin 20 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110322491 (Il20)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110322491 (Il20)    04061 Viral protein interaction with cytokine and cytokine receptor     110322491 (Il20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110322491 (Il20) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110322491 (Il20) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 Motif Other DBs NCBI-GeneID:  110322491 NCBI-ProteinID:  XP_021054825 Ensembl:  MGP_PahariEiJ_G0027797 LinkDB All DBs Position 5:complement(105199606..105203118) Genome browser AA seq 176 aa AA seqDB search MKGFGLAFGLFSAVGFLLWTPLTGLKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDANI DIRILRTTESLKDIKPLDRCCFLRRLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIK KDLSVCHSHMACHCGEEAMEKYNQILSHFTELELQAAVVKALGELGILLRWMEEML NT seq 531 nt NT seq  +upstreamnt  +downstreamnt atgaaaggctttggtcttgcctttggactgttctctgctgtgggttttcttctctggact cctttaactgggctcaagacccttcatttgggaagctgtgtgatcactgcaaacctacag gcaatacaaaaggaattttctgagattcgggatagtgtgcaagctgaagatgcaaatatt gacatcagaattttaaggacaactgagtctttgaaagacataaagcctttggataggtgc tgcttcctccgccgtctagtgagattctatctggacagggtattcaaagtctaccagacc cctgaccaccacaccctgagaaagatcagcagcctcgccaactcctttcttatcatcaag aaggacctctcagtctgtcactctcacatggcatgtcattgtggggaagaagcaatggag aaatacaaccaaattctgagtcacttcacagagttggagcttcaggcagcggtggtaaag gctttgggggaactaggcattcttctgagatggatggaggagatgctgtag

DBGET integrated database retrieval system