KEGG   Mus pahari (shrew mouse): 110315179
Entry
110315179         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110315179
   04151 PI3K-Akt signaling pathway
    110315179
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110315179
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110315179
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110315179
   04621 NOD-like receptor signaling pathway
    110315179
   04622 RIG-I-like receptor signaling pathway
    110315179
   04623 Cytosolic DNA-sensing pathway
    110315179
   04650 Natural killer cell mediated cytotoxicity
    110315179
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110315179
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315179
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110315179
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110315179
   05161 Hepatitis B
    110315179
   05160 Hepatitis C
    110315179
   05171 Coronavirus disease - COVID-19
    110315179
   05164 Influenza A
    110315179
   05162 Measles
    110315179
   05168 Herpes simplex virus 1 infection
    110315179
   05163 Human cytomegalovirus infection
    110315179
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315179
   05169 Epstein-Barr virus infection
    110315179
   05165 Human papillomavirus infection
    110315179
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110315179
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110315179
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110315179
NCBI-ProteinID: XP_021044962
LinkDB
Position
Unknown
AA seq 189 aa
MARLCAFLVILIVMSYWSACSLGCHLPHTSNLRNKRALTLLEQLRRLPPLSCLKDRKDFG
FHLENVDAQQVQKAQAILVLRDLTQQILNLFTRKDSSATWNATLLDSFCNDLHQQLNDLK
ACVMQEVVVQEPPLIQEDSLAVRIYFHRISVYLRKKKHSPCAWEVVRAEVWRALSSSAKL
LARLSKEEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttccttgtgatcctgatagtgatgagctactggtcagcgtgt
tctctaggatgtcacctgcctcacacttctaacctcaggaacaagagggccttgacactc
ctggaacaactgagaagactcccccctctttcctgcctgaaggacaggaaggactttgga
ttccatttggagaatgtggatgcccaacaggtccagaaggctcaagccatccttgtgctg
agagaccttacccagcagatcttgaacctcttcacaagaaaggactcatctgctacttgg
aatgcaactctcctagactccttctgcaatgacctccaccagcagctcaacgacctcaaa
gcctgtgtgatgcaggaggttgtggtgcaggaacctcccctgatccaggaagactccctg
gctgtgagaatatacttccacaggatctctgtgtacctgagaaagaagaaacacagcccc
tgtgcctgggaagtggtcagagcagaagtctggagagccctgtcttcctcagccaagctg
ctggcaagactgagtaaggaggaggagtga

KEGG   Mus pahari (shrew mouse): 110315688
Entry
110315688         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110315688
   04151 PI3K-Akt signaling pathway
    110315688
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110315688
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110315688
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110315688
   04621 NOD-like receptor signaling pathway
    110315688
   04622 RIG-I-like receptor signaling pathway
    110315688
   04623 Cytosolic DNA-sensing pathway
    110315688
   04650 Natural killer cell mediated cytotoxicity
    110315688
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110315688
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315688
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110315688
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110315688
   05161 Hepatitis B
    110315688
   05160 Hepatitis C
    110315688
   05171 Coronavirus disease - COVID-19
    110315688
   05164 Influenza A
    110315688
   05162 Measles
    110315688
   05168 Herpes simplex virus 1 infection
    110315688
   05163 Human cytomegalovirus infection
    110315688
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315688
   05169 Epstein-Barr virus infection
    110315688
   05165 Human papillomavirus infection
    110315688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110315688
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110315688
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110315688
NCBI-ProteinID: XP_021045340
LinkDB
Position
Unknown
AA seq 188 aa
MARLCAFLVILIVMSHWSACSLGCDLPHTFNLRNKRALTLLEQLRRLPPLSCLKDRKDFG
LPLEKVDTQHVQKAQAILVLRDLTQQILNLFTTKASSAAWNATLLDSFCNDLHQQLNDLK
ACVMQEVVGQEPPLTQEDSLMAVRIYFHRITVYLRKKKHSPCAWEVVRVEVWRALSSSAK
LLARLSEE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggcaaggctctgtgctttcctcgtgatcctgatagtgatgagccactggtcagcgtgt
tctctaggatgtgacctgcctcacactttcaacctcaggaacaagagggccttgacactc
ctggaacaactgagaagactcccccctctttcctgcctgaaggacaggaaggactttgga
ttgcctttggagaaggtggatacccaacatgtccagaaggctcaagccatccttgtgctg
agagatcttacccagcagatcttgaacctcttcacaacaaaggcttcatcagctgcttgg
aatgcaactctcctagactccttctgcaatgacctccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaggaggttgtgggacaggaacctcctctgacccaggaagactccctg
atggctgtgagaatatacttccacaggatcactgtgtaccttagaaagaagaaacacagc
ccctgtgcctgggaggtggtcagagtagaagtctggagagccctgtcttcctcagccaag
ctgctggcaagactgagtgaggagtaa

KEGG   Mus pahari (shrew mouse): 110317140
Entry
110317140         CDS       T05929                                 

Gene name
Il6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01523  Antifolate resistance
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04218  Cellular senescence
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04657  IL-17 signaling pathway
mpah04659  Th17 cell differentiation
mpah04668  TNF signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05010  Alzheimer disease
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05321  Inflammatory bowel disease
mpah05323  Rheumatoid arthritis
mpah05332  Graft-versus-host disease
mpah05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110317140 (Il6)
   04668 TNF signaling pathway
    110317140 (Il6)
   04066 HIF-1 signaling pathway
    110317140 (Il6)
   04068 FoxO signaling pathway
    110317140 (Il6)
   04151 PI3K-Akt signaling pathway
    110317140 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110317140 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110317140 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110317140 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110317140 (Il6)
   04620 Toll-like receptor signaling pathway
    110317140 (Il6)
   04621 NOD-like receptor signaling pathway
    110317140 (Il6)
   04623 Cytosolic DNA-sensing pathway
    110317140 (Il6)
   04625 C-type lectin receptor signaling pathway
    110317140 (Il6)
   04659 Th17 cell differentiation
    110317140 (Il6)
   04657 IL-17 signaling pathway
    110317140 (Il6)
   04672 Intestinal immune network for IgA production
    110317140 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317140 (Il6)
   05202 Transcriptional misregulation in cancer
    110317140 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110317140 (Il6)
   05321 Inflammatory bowel disease
    110317140 (Il6)
   05332 Graft-versus-host disease
    110317140 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110317140 (Il6)
   05020 Prion disease
    110317140 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    110317140 (Il6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110317140 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110317140 (Il6)
   04931 Insulin resistance
    110317140 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110317140 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110317140 (Il6)
   05135 Yersinia infection
    110317140 (Il6)
   05133 Pertussis
    110317140 (Il6)
   05134 Legionellosis
    110317140 (Il6)
   05152 Tuberculosis
    110317140 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110317140 (Il6)
   05161 Hepatitis B
    110317140 (Il6)
   05171 Coronavirus disease - COVID-19
    110317140 (Il6)
   05164 Influenza A
    110317140 (Il6)
   05162 Measles
    110317140 (Il6)
   05168 Herpes simplex virus 1 infection
    110317140 (Il6)
   05163 Human cytomegalovirus infection
    110317140 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110317140 (Il6)
   05169 Epstein-Barr virus infection
    110317140 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110317140 (Il6)
   05144 Malaria
    110317140 (Il6)
   05142 Chagas disease
    110317140 (Il6)
   05143 African trypanosomiasis
    110317140 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110317140 (Il6)
   01523 Antifolate resistance
    110317140 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110317140 (Il6)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110317140 (Il6)
SSDB
Motif
Pfam: IL6 IL23
Other DBs
NCBI-GeneID: 110317140
NCBI-ProteinID: XP_021047197
Ensembl: MGP_PahariEiJ_G0021821
LinkDB
Position
2
AA seq 211 aa
MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITQVLR
EILAMRKELCNGNPDCMNNDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKITSGLLEY
QIYLEYMKNNLKDNKKDKARVIQRDTETLIYIFNQEVKDLYKIVLPSPISDPLLMEKMES
QKEWLRTKTIQFILKALEEFLKVTLRSTRQT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaagttcctctctgcaagagacttccatccagttgccttcttgggactgatgctggtg
acaaccacggccttccctacttcacaagtccggagaggagacttcacagaggacaccact
cccaacagaccagtatacaccacttcacaagtcggaggcttaattacacaagttctcagg
gaaatcttggcaatgagaaaagagttgtgcaatggcaatcctgattgtatgaacaacgat
gatgcactttcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgcttc
caaactggatacaatcaggaaatttgcctattgaaaattacctctggtcttctggagtac
caaatctacctggagtacatgaagaacaacttaaaagataacaagaaagacaaagccaga
gtcattcagagagatacagaaaccctaatttatatcttcaatcaagaggtaaaagattta
tataaaatagtccttcctagcccaatttccgatcctctcctaatggagaagatggagtca
cagaaggagtggctaaggaccaagaccatccaattcatcttgaaagcacttgaagaattt
ctaaaagtcactttgagatctactcggcaaacctag

KEGG   Mus pahari (shrew mouse): 110317734
Entry
110317734         CDS       T05929                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110317734
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110317734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110317734
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110317734
SSDB
Motif
Pfam: PRF CNTF IL11 LIF_OSM EPO_TPO
Other DBs
NCBI-GeneID: 110317734
NCBI-ProteinID: XP_021048076
Ensembl: MGP_PahariEiJ_G0013723
LinkDB
Position
1
AA seq 204 aa
MYCLLATPLCLLSLLLPPLSPAAPISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPF
SDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRVQGAFLALTQHLQLVGDDQSYLNP
GSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGLVPFGASAFERKCRGYIV
TREYGHWTDRAVRDLALLKAKYPA
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtactgcctgctggcaactcccctatgcctactgagcctgctgttgccacccctcagt
cctgcggcccccatctccccatcagagcccatcggtcaagcctacagcctggctctctac
atgcagaagaacacgtcagcattgctacagacctatctccagcaccagggcagccccttc
agcgaccccggcttctcagctcccgagctccagctcagcaccctgccttctgcagctgtc
tccttcaagacctggcatgcaatggaagatgcagagcggctaagccgagtccagggagcc
tttctggccttgacccagcacctccagctcgtgggggacgaccagagttatctgaatcct
ggcagtcctatcctgctggcccagctaggagcagcaagactcagggcccaaggcctattg
ggcaacatggctgctatcatgacggctctagggctgcccatccctccagaagaggatact
ctggggcttgtcccttttggggcctcagcctttgaaaggaaatgcagaggctacatagtg
acccgagaatatggtcactggacagacagggctgtgagggacttggctctccttaaggct
aagtacccagcatag

KEGG   Mus pahari (shrew mouse): 110317740
Entry
110317740         CDS       T05929                                 

Gene name
Ctf1
Definition
(RefSeq) cardiotrophin-1 isoform X1
  KO
K05422  cardiotrophin 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110317740 (Ctf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110317740 (Ctf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110317740 (Ctf1)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110317740 (Ctf1)
SSDB
Motif
Pfam: LIF_OSM PRF
Other DBs
NCBI-GeneID: 110317740
NCBI-ProteinID: XP_021048090
Ensembl: MGP_PahariEiJ_G0013722
LinkDB
Position
1
AA seq 203 aa
MSQREGSLEDHQSGSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPG
FSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLR
SLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVC
GLYGEWVSRTEGDLGQLVPGGVA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagccagagggagggaagtctggaagaccaccagtctggctcctcaatctcattccta
ccccatttggaggccaagatccgccagacacacaaccttgcccgcctcctgaccaaatat
gcagaacaactgctggaagaatacgtgcagcaacagggagagccctttgggctgccgggc
ttctcaccaccgcggctgccgctggccggcctgagtggcccggctccgagccatgcaggg
ctaccggtgtctgagcggctgcggcaggatgcagccgccctgagtgtgctgcccgcgctg
ttggatgcggtccgccgccgccaggcggagctgaacccgcgcgccccgcgcctgctgcgg
agcctggaggacgcggcccgccaggttcgggccctgggcgccgcggtggagacggtgctg
gccgctctgggcgctgcagcccgcgggcccgggccagagcccgtcaccgtcgccaccctc
ttcacggccaacagcactgcaggcatcttctcagccaaggtgctggggttccacgtgtgc
ggcctctatggcgagtgggtgagccgcaccgagggcgacctgggccagctggtgccaggg
ggcgtcgcctga

KEGG   Mus pahari (shrew mouse): 110320556
Entry
110320556         CDS       T05929                                 

Gene name
Il2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04151  PI3K-Akt signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110320556 (Il2)
   04151 PI3K-Akt signaling pathway
    110320556 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110320556 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110320556 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110320556 (Il2)
   04660 T cell receptor signaling pathway
    110320556 (Il2)
   04658 Th1 and Th2 cell differentiation
    110320556 (Il2)
   04659 Th17 cell differentiation
    110320556 (Il2)
   04672 Intestinal immune network for IgA production
    110320556 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320556 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110320556 (Il2)
   05321 Inflammatory bowel disease
    110320556 (Il2)
   05330 Allograft rejection
    110320556 (Il2)
   05332 Graft-versus-host disease
    110320556 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110320556 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110320556 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110320556 (Il2)
   05171 Coronavirus disease - COVID-19
    110320556 (Il2)
   05162 Measles
    110320556 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110320556 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110320556 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110320556 (Il2)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110320556 (Il2)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110320556 (Il2)
SSDB
Motif
Pfam: IL2 DUF3446 OGG_N
Other DBs
NCBI-GeneID: 110320556
NCBI-ProteinID: XP_021052288
Ensembl: MGP_PahariEiJ_G0026385
LinkDB
Position
4
AA seq 166 aa
MYSMQLASCVALTLVFLVNSAPTSSPTSSSTSSSTAEAQQQQQHLEQLLMDLQELLSRME
NYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGALQRVLDLTQSKSFQLEDAENFISN
IRVTVIKLKGSENTLECQFADESVTVVEFLRRWIAFCQSIISARPQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtacagcatgcagctcgcatcctgtgtcgcactgacacttgtgttccttgtcaacagt
gcacccacttcaagccccacttcaagttccacttcaagctctacagcggaagcacagcag
cagcagcagcacctggagcagctgttgatggacctacaggagctcttgagcaggatggag
aattacaggaacctgaaactccccaggatgctcaccttcaaattttacttgcccaagcag
gccacagaattgaaagatcttcagtgcctagaagatgaactcggagctctgcagcgtgtg
ctggatttgactcaaagcaaaagctttcaattggaagatgctgagaatttcatcagtaat
atcagagtaactgttataaaactaaagggctctgaaaacacacttgagtgccaatttgct
gatgagtcagtgactgtggtggaatttctgaggagatggatagccttctgtcaaagcatc
atctcagcaaggcctcaataa

KEGG   Mus pahari (shrew mouse): 110320680
Entry
110320680         CDS       T05929                                 

Gene name
Il12a
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04620  Toll-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04940  Type I diabetes mellitus
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05162  Measles
mpah05164  Influenza A
mpah05168  Herpes simplex virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05321  Inflammatory bowel disease
mpah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110320680 (Il12a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110320680 (Il12a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110320680 (Il12a)
   04622 RIG-I-like receptor signaling pathway
    110320680 (Il12a)
   04625 C-type lectin receptor signaling pathway
    110320680 (Il12a)
   04658 Th1 and Th2 cell differentiation
    110320680 (Il12a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320680 (Il12a)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110320680 (Il12a)
   05330 Allograft rejection
    110320680 (Il12a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110320680 (Il12a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110320680 (Il12a)
   05134 Legionellosis
    110320680 (Il12a)
   05152 Tuberculosis
    110320680 (Il12a)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110320680 (Il12a)
   05164 Influenza A
    110320680 (Il12a)
   05162 Measles
    110320680 (Il12a)
   05168 Herpes simplex virus 1 infection
    110320680 (Il12a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110320680 (Il12a)
   05144 Malaria
    110320680 (Il12a)
   05145 Toxoplasmosis
    110320680 (Il12a)
   05140 Leishmaniasis
    110320680 (Il12a)
   05142 Chagas disease
    110320680 (Il12a)
   05143 African trypanosomiasis
    110320680 (Il12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110320680 (Il12a)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110320680 (Il12a)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110320680 (Il12a)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110320680 (Il12a)
SSDB
Motif
Pfam: IL12 DUF2564
Other DBs
NCBI-GeneID: 110320680
NCBI-ProteinID: XP_021052456
Ensembl: MGP_PahariEiJ_G0026502
LinkDB
Position
4
AA seq 236 aa
MVNVPTASPSASSSSSQCRSSMCQSRYLLFLATLAFLNYLSLARVIPVSGPARCLSQSQN
LLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDKTSTLETCLPLELHKNESCLATRDAS
STTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKSMLVAI
DELMQSLNHNGETQRQNPPVGVADPYRVKMKLCILLHAFSTRVVTINRVMSYLSSS
NT seq 711 nt   +upstreamnt  +downstreamnt
atggtcaatgttccaaccgcctcaccctcggcatccagcagctcctctcagtgccggtcc
agcatgtgtcaatcacgctacctcctctttttggccacccttgccttcctaaactacctc
agtttggccagggtcattccagtctctggacctgccaggtgtcttagccagtcccaaaat
ctgctgaagaccacagatgacatggtgaagacggccagagaaaaactgaaacattattcc
tgcactgctgaagacatcgatcatgaagacatcacacgggacaaaaccagcacactggag
acctgtttaccactggaactacacaagaacgagagttgcctggctactagagatgcttct
tccacaacaagagggagctgcctgcccccacagaagacttctttgatgatgaccctgtgc
cttggtagcatctatgaggacttgaagatgtaccagacagagttccaggccataaatgca
gcacttcagaatcacaatcatcagcagatcattctggacaaaagcatgctggtagctatt
gatgagctgatgcagtctctgaatcataacggcgagactcagcgccagaacccccccgtg
ggagtagcagatccttacagagtgaaaatgaagctctgcatcctgctccatgccttcagc
acccgagtggtgaccatcaacagggtgatgagctacctgagctcttcctga

KEGG   Mus pahari (shrew mouse): 110320935
Entry
110320935         CDS       T05929                                 

Gene name
Il21
Definition
(RefSeq) interleukin-21 isoform X1
  KO
K05434  interleukin 21
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04659  Th17 cell differentiation
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110320935 (Il21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110320935 (Il21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110320935 (Il21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    110320935 (Il21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110320935 (Il21)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110320935 (Il21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 110320935
NCBI-ProteinID: XP_021052672
Ensembl: MGP_PahariEiJ_G0026386
LinkDB
Position
4
AA seq 162 aa
MERTLVCLVVIFLGTVAHKSSPQGPDRLLIRLHHLIDIVEQLKIYENDLDPELLSAPQDV
KVHCEHAAFACFQKATLKPSNPGNNKTFIGDLVAQLRRRLPARRRGKKQKHITKCPSCDS
YEKRTPKEFLERLKWLLQKVRTLNAFLSLPCCPRVPLVPSDS
NT seq 489 nt   +upstreamnt  +downstreamnt
atggagaggacccttgtctgtctggtagtcatcttcttggggacagtggcccataaatca
agcccccaagggccagatcgcctcctgattagacttcatcaccttatagacattgttgaa
cagctgaaaatctatgaaaatgacttggatcctgaacttctatcagctccacaagatgta
aaggtgcactgtgagcatgcagcttttgcctgttttcagaaggccacactcaagccatca
aaccctggaaacaataagacattcatcggtgacttggtggcacagctgaggaggaggctg
cctgccaggaggcgaggaaagaaacagaagcacataactaaatgcccatcctgtgattcg
tatgagaaaagaacacccaaggaattcctagaaagactaaaatggctccttcaaaaggta
cgcaccttaaatgcatttctttcacttccatgttgtccccgggtacctcttgtgcccagt
gactcatag

KEGG   Mus pahari (shrew mouse): 110321006
Entry
110321006         CDS       T05929                                 

Gene name
Il7
Definition
(RefSeq) interleukin-7 isoform X1
  KO
K05431  interleukin 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110321006 (Il7)
   04151 PI3K-Akt signaling pathway
    110321006 (Il7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110321006 (Il7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110321006 (Il7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321006 (Il7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110321006 (Il7)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110321006 (Il7)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110321006 (Il7)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110321006 (Il7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 110321006
NCBI-ProteinID: XP_021052746
Ensembl: MGP_PahariEiJ_G0026278
LinkDB
Position
4
AA seq 156 aa
MFHVSFRYIFGIPPLILVLLPATSSECHIKDKEGKAYESVLMISIDELVRDKMTGTDSNC
LNNEPNFFKKHLCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLRVSQGTQTLVNCTS
KEEKNVKEQKRNDACFLKRLLREIKTCWNKILKGSI
NT seq 471 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttagatatatctttggaattcctccactgatccttgttctgctg
cctgccacgtcatctgagtgccacattaaagacaaagaaggtaaagcatatgagagtgtg
ctgatgatcagcatcgatgaattggtacgtgacaaaatgacaggaactgatagcaattgc
ctgaataatgaaccaaacttttttaaaaaacatctatgtgatgatacaaaggaagctgct
tttctaaatcgtgctgctcgcaagttgaagcaatttcttaaaatgaatatcagtgaagaa
ttcaatgtccacttactgagagtgtcacaaggcacacaaacactggtgaactgcacaagt
aaggaagaaaaaaacgtaaaggaacagaaaaggaatgatgcatgtttcctaaagagacta
ctgagagagataaaaacttgttggaataaaattttgaagggcagtatatga

KEGG   Mus pahari (shrew mouse): 110322491
Entry
110322491         CDS       T05929                                 

Gene name
Il20
Definition
(RefSeq) interleukin-20 isoform X1
  KO
K22667  interleukin 20
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322491 (Il20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110322491 (Il20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110322491 (Il20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110322491 (Il20)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110322491 (Il20)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 110322491
NCBI-ProteinID: XP_021054825
Ensembl: MGP_PahariEiJ_G0027797
LinkDB
Position
5
AA seq 176 aa
MKGFGLAFGLFSAVGFLLWTPLTGLKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDANI
DIRILRTTESLKDIKPLDRCCFLRRLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIK
KDLSVCHSHMACHCGEEAMEKYNQILSHFTELELQAAVVKALGELGILLRWMEEML
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaaggctttggtcttgcctttggactgttctctgctgtgggttttcttctctggact
cctttaactgggctcaagacccttcatttgggaagctgtgtgatcactgcaaacctacag
gcaatacaaaaggaattttctgagattcgggatagtgtgcaagctgaagatgcaaatatt
gacatcagaattttaaggacaactgagtctttgaaagacataaagcctttggataggtgc
tgcttcctccgccgtctagtgagattctatctggacagggtattcaaagtctaccagacc
cctgaccaccacaccctgagaaagatcagcagcctcgccaactcctttcttatcatcaag
aaggacctctcagtctgtcactctcacatggcatgtcattgtggggaagaagcaatggag
aaatacaaccaaattctgagtcacttcacagagttggagcttcaggcagcggtggtaaag
gctttgggggaactaggcattcttctgagatggatggaggagatgctgtag

KEGG   Mus pahari (shrew mouse): 110322547
Entry
110322547         CDS       T05929                                 

Gene name
Il10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04068  FoxO signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322547 (Il10)
   04068 FoxO signaling pathway
    110322547 (Il10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110322547 (Il10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110322547 (Il10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110322547 (Il10)
   04660 T cell receptor signaling pathway
    110322547 (Il10)
   04672 Intestinal immune network for IgA production
    110322547 (Il10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110322547 (Il10)
   05322 Systemic lupus erythematosus
    110322547 (Il10)
   05320 Autoimmune thyroid disease
    110322547 (Il10)
   05321 Inflammatory bowel disease
    110322547 (Il10)
   05330 Allograft rejection
    110322547 (Il10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110322547 (Il10)
   05133 Pertussis
    110322547 (Il10)
   05150 Staphylococcus aureus infection
    110322547 (Il10)
   05152 Tuberculosis
    110322547 (Il10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110322547 (Il10)
   05144 Malaria
    110322547 (Il10)
   05145 Toxoplasmosis
    110322547 (Il10)
   05140 Leishmaniasis
    110322547 (Il10)
   05142 Chagas disease
    110322547 (Il10)
   05143 African trypanosomiasis
    110322547 (Il10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110322547 (Il10)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110322547 (Il10)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110322547 (Il10)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110322547 (Il10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 110322547
NCBI-ProteinID: XP_021054894
Ensembl: MGP_PahariEiJ_G0027799
LinkDB
Position
5
AA seq 178 aa
MPGSALLCCLLLLAGVRISRGQYTREDNNCTHFPVSQTHMLRELRTAFSQVKTFFQTKDQ
LDNILLNDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLR
MRLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYMKIKMKS
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcctggctcagcactgctatgctgcctgctcttactggctggtgtgaggatcagcaga
ggccagtacacccgggaagacaacaactgcacccatttcccagtcagccagacccacatg
ctccgagagctgcggacggccttcagccaggtgaagactttctttcaaacaaaggaccag
ctggacaacatactgctaaacgattccttaatgcaggactttaagggttacttgggttgc
caagccttatcagaaatgatccagttttacctggtagaagtgatgccccaagcagagaag
catggcccggaaatcaaggagcatttgaattccctgggagagaagctgaagaccctcagg
atgcggctgcggcgctgtcatcgatttctcccctgtgaaaataagagcaaggcggtggag
caggtgaagaatgattttaataagctccaagacaaaggcgtctacaaggccatgaatgaa
tttgacatcttcatcaactgcatagaagcatacatgaagatcaaaatgaaaagctaa

KEGG   Mus pahari (shrew mouse): 110322551
Entry
110322551         CDS       T05929                                 

Gene name
Il24
Definition
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322551 (Il24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110322551 (Il24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110322551 (Il24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110322551 (Il24)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110322551 (Il24)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 110322551
NCBI-ProteinID: XP_021054898
Ensembl: MGP_PahariEiJ_G0027796
LinkDB
Position
5
AA seq 181 aa
MSWGLQILPCLSLILLLWNQVPGLQGQEFRFGPCHVTRVVLPELWEAFWTVKNTVQTQDD
ITSVRLLKPQVLQNVSDAESCYLAQSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFI
VIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDIEVALVKAFGEVDILLTWMQKFYQ
L
NT seq 546 nt   +upstreamnt  +downstreamnt
atgagctggggactacagattctcccctgcctgagcctaatccttcttctttggaaccaa
gtaccagggcttcagggtcaagagttccgatttgggccttgccatgtgaccagagtggtt
ctcccagaactgtgggaggccttctggactgtgaagaacactgtgcaaactcaggatgac
atcacaagcgtccggctgttgaagccgcaggttcttcagaatgtctcggatgctgagagc
tgttaccttgcccagagcctgctgaagttctacctgaacaccgttttcaagaactaccac
agcaaaatagccaaattcaaggtcttgaggtcgttctccactctggccaacaacttcata
gtcatcatgtcacaactgcagcccagtaaggacaattccatgcttcccattagtgagagt
gcacaccagcggtttttgctgttccgcagagcattcaaacagttggatatagaagtcgct
ttggtgaaagcctttggggaagtggacattctcctgacctggatgcagaagttctaccag
ctctga

KEGG   Mus pahari (shrew mouse): 110322622
Entry
110322622         CDS       T05929                                 

Gene name
Il19
Definition
(RefSeq) interleukin-19
  KO
K05444  interleukin 19
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322622 (Il19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110322622 (Il19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110322622 (Il19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110322622 (Il19)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110322622 (Il19)
SSDB
Motif
Pfam: IL10 DUF676
Other DBs
NCBI-GeneID: 110322622
NCBI-ProteinID: XP_021054985
Ensembl: MGP_PahariEiJ_G0027798
LinkDB
Position
5
AA seq 176 aa
MKAQCASPWLLGMTFILCSVHIYSLRRCLISVDMRLIEKSFHEIKRALHTKDTFKNVTIL
SLENLRSIKPGDVCCVTNNLLTFYRDRVFKDHQETSLEVVRRISNLANSFLYMQRTLEQC
QVHRQCHCSQEATNATRIIHDNYSQLEVSSAALKSLGELNILLAWIDRNHQETPAA
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaggcacagtgcgcgtctccctggctcctgggcatgacgttcattctctgctcagtt
catatctacagtcttaggagatgtctgatttctgtggacatgcgcctcatagaaaagagt
ttccacgagatcaagagagccctgcacactaaggacaccttcaaaaatgtcaccatcctg
tccctggagaacctcaggagcattaagcctggagatgtgtgctgcgtgaccaacaacctg
ctgacattctacagagacagggtcttcaaggaccatcaggagacaagccttgaggtcgtg
aggagaatcagcaaccttgctaactctttcctctacatgcagagaactctggagcaatgt
caggtgcacagacaatgtcactgcagtcaggaagccaccaatgcaaccagaatcatccat
gacaattacagtcagctggaggtctcatctgctgcccttaagtctctaggagaactgaac
atacttttagcctggattgacaggaatcatcaggaaactcctgcagcctga

KEGG   Mus pahari (shrew mouse): 110322994
Entry
110322994         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-11-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322994
   04151 PI3K-Akt signaling pathway
    110322994
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110322994
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110322994
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110322994
   04621 NOD-like receptor signaling pathway
    110322994
   04622 RIG-I-like receptor signaling pathway
    110322994
   04623 Cytosolic DNA-sensing pathway
    110322994
   04650 Natural killer cell mediated cytotoxicity
    110322994
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322994
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110322994
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110322994
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110322994
   05161 Hepatitis B
    110322994
   05160 Hepatitis C
    110322994
   05171 Coronavirus disease - COVID-19
    110322994
   05164 Influenza A
    110322994
   05162 Measles
    110322994
   05168 Herpes simplex virus 1 infection
    110322994
   05163 Human cytomegalovirus infection
    110322994
   05167 Kaposi sarcoma-associated herpesvirus infection
    110322994
   05169 Epstein-Barr virus infection
    110322994
   05165 Human papillomavirus infection
    110322994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110322994
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110322994
SSDB
Motif
Pfam: Interferon Syntaxin-6_N
Other DBs
NCBI-GeneID: 110322994
NCBI-ProteinID: XP_021055659
LinkDB
Position
6
AA seq 189 aa
MARLCAFLVILIVMSHWSACSLGCDLPHTFDLRNKRALTLLEQLRRLSPLSCLKDRKDFG
LPLEKVDTQQIQKAQAIPVLRNLTQQILNLFTTKDSSATWNATLLDTFCNDLHQQLNDLK
ACVMQEVGVQEFPLTQEDSLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANL
LARLSEEKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcgtgatcctgatagtgatgagccactggtcagcgtgt
tctctaggatgtgacctgcctcacacttttgacctcaggaacaagagggccttgacactc
ctggaacaactgagaagactctcccctctttcctgcctgaaggacaggaaggactttgga
ttgcctttggagaaggtggatacccaacagatccagaaggctcaagccatccctgtcctt
cgaaatcttacccagcagatcctgaacctcttcacaacaaaggactcatctgctacttgg
aatgcaactctcctagacaccttctgcaatgacctccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaggaggttggggtgcaggaatttcccttgacccaggaagactccctg
gctgtgaggaaatacttccacaggatcacagtgtacctgagagagaagaaacacagcccc
tgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaacttg
ctggcaagactgagtgaggagaaggagtga

KEGG   Mus pahari (shrew mouse): 110323165
Entry
110323165         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-5
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323165
   04151 PI3K-Akt signaling pathway
    110323165
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323165
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323165
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323165
   04621 NOD-like receptor signaling pathway
    110323165
   04622 RIG-I-like receptor signaling pathway
    110323165
   04623 Cytosolic DNA-sensing pathway
    110323165
   04650 Natural killer cell mediated cytotoxicity
    110323165
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323165
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323165
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323165
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323165
   05161 Hepatitis B
    110323165
   05160 Hepatitis C
    110323165
   05171 Coronavirus disease - COVID-19
    110323165
   05164 Influenza A
    110323165
   05162 Measles
    110323165
   05168 Herpes simplex virus 1 infection
    110323165
   05163 Human cytomegalovirus infection
    110323165
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323165
   05169 Epstein-Barr virus infection
    110323165
   05165 Human papillomavirus infection
    110323165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323165
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323165
SSDB
Motif
Pfam: Interferon DUF4569
Other DBs
NCBI-GeneID: 110323165
NCBI-ProteinID: XP_021055956
LinkDB
Position
6
AA seq 189 aa
MARPCAFLMVLMVMSYWSTCSLGCDLPQSHNFRNKRTLTLLVQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWDATLLDSFCNDLHQHLNDLQ
GCLIQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLARLSEEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggccttgtgctttcctcatggtcttgatggtgatgagctactggtcaacctgt
tctctaggatgtgacctgcctcagagtcataacttcaggaacaagagaaccttgacactc
ctggtacaaatgaggagactctccccnctctcctgcctgaaggacaggaaggactttgga
ttcccccaggagaaggtggatgcacagcagatccaggaggctcaagccatccctgtcctg
agtgagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcaactctcctagactcattctgcaatgacctccaccagcatctcaatgacctgcaa
ggctgtctgatacagcaggtgggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtctacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagactgagtgaggaggagtga

KEGG   Mus pahari (shrew mouse): 110323303
Entry
110323303         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323303
   04151 PI3K-Akt signaling pathway
    110323303
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323303
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323303
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323303
   04621 NOD-like receptor signaling pathway
    110323303
   04622 RIG-I-like receptor signaling pathway
    110323303
   04623 Cytosolic DNA-sensing pathway
    110323303
   04650 Natural killer cell mediated cytotoxicity
    110323303
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323303
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323303
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323303
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323303
   05161 Hepatitis B
    110323303
   05160 Hepatitis C
    110323303
   05171 Coronavirus disease - COVID-19
    110323303
   05164 Influenza A
    110323303
   05162 Measles
    110323303
   05168 Herpes simplex virus 1 infection
    110323303
   05163 Human cytomegalovirus infection
    110323303
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323303
   05169 Epstein-Barr virus infection
    110323303
   05165 Human papillomavirus infection
    110323303
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323303
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323303
SSDB
Motif
Pfam: Interferon DDHD
Other DBs
NCBI-GeneID: 110323303
NCBI-ProteinID: XP_021056108
LinkDB
Position
6
AA seq 150 aa
MDNPVLSRSCALLITLVMSYWSIFSLGCDLPQTHNLRNKRALILLVEMRRLSPLSCLKDR
KDFEFPQEKVDAQQIQKAQAIPVLSELIQQILNIFSSKDPFAAWEATFPDSFCDYLHQQL
NDMQACLMQLVGRQEHPLTLEDSLVAMKKY
NT seq 450 nt   +upstreamnt  +downstreamnt
atggacaacccagtgttgtctaggtcctgtgctttactgataaccctggtgatgagctac
tggtcaattttctctctaggatgtgacctgcctcagacacataacctcaggaacaagaga
gccttgattctcctagttgaaatgaggagactctcccctctctcctgcctgaaggacaga
aaggacttcgaattcccccaggagaaggtagatgcccagcagattcagaaggctcaagcc
atccctgtcctgagtgaactgatccaacagatcctgaacatctttagctcaaaggaccca
tttgcagcttgggaggcaaccttcccagactcgttttgtgattacctccaccagcaactc
aatgacatgcaagcttgtctgatgcagctggtggggaggcaggaacatcccttgactttg
gaagactccctggtggccatgaagaaatac

KEGG   Mus pahari (shrew mouse): 110323342
Entry
110323342         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323342
   04151 PI3K-Akt signaling pathway
    110323342
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323342
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323342
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323342
   04621 NOD-like receptor signaling pathway
    110323342
   04622 RIG-I-like receptor signaling pathway
    110323342
   04623 Cytosolic DNA-sensing pathway
    110323342
   04650 Natural killer cell mediated cytotoxicity
    110323342
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323342
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323342
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323342
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323342
   05161 Hepatitis B
    110323342
   05160 Hepatitis C
    110323342
   05171 Coronavirus disease - COVID-19
    110323342
   05164 Influenza A
    110323342
   05162 Measles
    110323342
   05168 Herpes simplex virus 1 infection
    110323342
   05163 Human cytomegalovirus infection
    110323342
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323342
   05169 Epstein-Barr virus infection
    110323342
   05165 Human papillomavirus infection
    110323342
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323342
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323342
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110323342
NCBI-ProteinID: XP_021056170
Ensembl: MGP_PahariEiJ_G0028482
LinkDB
Position
6
AA seq 190 aa
MARLCAFLMVLVVMSYWSTCSLGCDLLQSHNLRYKRALTLLVQMRRLSPISCLKDRKDFG
FPQEKVDAQQIQETQAIPVLSELTQQVLNIFTSKESSGAWNATLLDSFCNDLHQHLNDLQ
GCLMQQVGVQEPPLTQEDSLMAVRKYFHRITVYLKEKKHSPCAWEVIRAEIWRALSSSAK
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcaaggctctgtgctttcctgatggtcctggtggtgatgagctactggtcaacctgc
tctctaggatgtgacctgcttcagagtcataacctcaggtacaagagagccttgacactc
ttggtacaaatgaggagactctcccccatctcctgcctgaaggacaggaaggactttgga
ttcccccaggagaaggtggatgcccagcagatccaggagactcaagccatccctgtcctg
agtgagctgacccagcaggtcctgaacatcttcacatcaaaggagtcatctggagcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcatctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaggaacctccactgacccaggaagactccctt
atggctgtgaggaaatacttccacaggatcactgtgtacctgaaagagaagaaacacagc
ccctgtgcctgggaggtgatcagagcagaaatctggagagccctgtcttcctcagccaag
ttgctagcaagactgagtgaggagaaggagtga

KEGG   Mus pahari (shrew mouse): 110323346
Entry
110323346         CDS       T05929                                 

Gene name
Ifnb1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04668  TNF signaling pathway
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323346 (Ifnb1)
   04668 TNF signaling pathway
    110323346 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    110323346 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323346 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323346 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323346 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    110323346 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    110323346 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    110323346 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    110323346 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110323346 (Ifnb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110323346 (Ifnb1)
   05152 Tuberculosis
    110323346 (Ifnb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323346 (Ifnb1)
   05161 Hepatitis B
    110323346 (Ifnb1)
   05160 Hepatitis C
    110323346 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    110323346 (Ifnb1)
   05164 Influenza A
    110323346 (Ifnb1)
   05162 Measles
    110323346 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    110323346 (Ifnb1)
   05163 Human cytomegalovirus infection
    110323346 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323346 (Ifnb1)
   05169 Epstein-Barr virus infection
    110323346 (Ifnb1)
   05165 Human papillomavirus infection
    110323346 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110323346 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323346 (Ifnb1)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323346 (Ifnb1)
SSDB
Motif
Pfam: Interferon Spore_III_AB Tat
Other DBs
NCBI-GeneID: 110323346
NCBI-ProteinID: XP_021056175
Ensembl: MGP_PahariEiJ_G0028479
LinkDB
Position
6
AA seq 182 aa
MNNRWILHAAFLLCFSTTALSINYEQLQLQQRTRIRKCQKLLEQLNGKINLSYRTDFKIP
MEMMEKMQKSYTAFAIQEMLQNVFLVFKNNFSSTGWNETIVERLLDELHGQTEFLKTILK
EKQEERLMWPVSSTALHLKSYYWRVQRYLKLNKYNSYAWMVVRAEIFRNFSIIRRLARNF
QN
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaacaataggtggatcctccacgctgcgttcctgctgtgcttctccaccacggccctc
tccatcaactacgagcagctccagctccaacaaaggacgaggattcggaaatgtcagaag
ctcctggagcagctgaatggaaagatcaacctcagctacaggacggacttcaagattcct
atggagatgatggagaagatgcagaagagttacactgcctttgccatccaagagatgctc
cagaatgtctttcttgtcttcaaaaacaatttctccagcaccgggtggaatgagactatt
gttgaacgcctcctggatgaactccatgggcagacagagtttctgaagacaatactaaag
gaaaagcaggaggaaagattgatgtggccggtatcctcaactgctctccacttgaagagc
tattactggagggtgcaaaggtaccttaaactcaataagtacaacagctatgcctggatg
gtggtccgagcagagatcttcaggaacttttccatcattcgaagacttgctagaaacttc
cagaactga

KEGG   Mus pahari (shrew mouse): 110323382
Entry
110323382         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-12-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323382
   04151 PI3K-Akt signaling pathway
    110323382
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323382
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323382
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323382
   04621 NOD-like receptor signaling pathway
    110323382
   04622 RIG-I-like receptor signaling pathway
    110323382
   04623 Cytosolic DNA-sensing pathway
    110323382
   04650 Natural killer cell mediated cytotoxicity
    110323382
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323382
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323382
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323382
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323382
   05161 Hepatitis B
    110323382
   05160 Hepatitis C
    110323382
   05171 Coronavirus disease - COVID-19
    110323382
   05164 Influenza A
    110323382
   05162 Measles
    110323382
   05168 Herpes simplex virus 1 infection
    110323382
   05163 Human cytomegalovirus infection
    110323382
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323382
   05169 Epstein-Barr virus infection
    110323382
   05165 Human papillomavirus infection
    110323382
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323382
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323382
SSDB
Motif
Pfam: Interferon DUF4569 APC1_C
Other DBs
NCBI-GeneID: 110323382
NCBI-ProteinID: XP_021056220
Ensembl: MGP_PahariEiJ_G0028483
LinkDB
Position
6
AA seq 189 aa
MARPCAFLMALMVMSYWSTCSLGCDLLPTHNFRNKRVLTLLVQMRRLSPLSCLKDRKDFR
FPQEKVDAQQIQKAQAMPVLSELTQQVLNIFTSKDSSAAWDATLLDSFCNDLYQQLSDLQ
GCLRQLVGVQEPPLTQEDSLMAMRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLARLSEEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggccttgtgctttcctcatggccttgatggtgatgagctactggtcaacctgc
tctctaggatgtgacctgcttccgactcataacttcaggaacaagagagttttgacactt
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttaga
ttcccccaggagaaggtggatgcccagcagatccagaaggctcaagccatgcctgtcctg
agtgagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcaaccctcctagactcattctgcaatgacctctatcagcagctcagtgacctgcaa
ggctgtctgaggcagcttgtgggggttcaggaacctcccttgacccaggaagactccctg
atggctatgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ctgctggcaagactgagtgaggaggagtga

KEGG   Mus pahari (shrew mouse): 110323390
Entry
110323390         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-5
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323390
   04151 PI3K-Akt signaling pathway
    110323390
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323390
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323390
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323390
   04621 NOD-like receptor signaling pathway
    110323390
   04622 RIG-I-like receptor signaling pathway
    110323390
   04623 Cytosolic DNA-sensing pathway
    110323390
   04650 Natural killer cell mediated cytotoxicity
    110323390
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323390
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323390
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323390
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323390
   05161 Hepatitis B
    110323390
   05160 Hepatitis C
    110323390
   05171 Coronavirus disease - COVID-19
    110323390
   05164 Influenza A
    110323390
   05162 Measles
    110323390
   05168 Herpes simplex virus 1 infection
    110323390
   05163 Human cytomegalovirus infection
    110323390
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323390
   05169 Epstein-Barr virus infection
    110323390
   05165 Human papillomavirus infection
    110323390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323390
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323390
SSDB
Motif
Pfam: Interferon DUF4569
Other DBs
NCBI-GeneID: 110323390
NCBI-ProteinID: XP_021056233
LinkDB
Position
6
AA seq 189 aa
MARPCAFLMVLMVMSYWSTCSLGCDLPQSHNFRNKRTLTLLVQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWDATLLDSFCNDLHQHLNDLQ
GCLIQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLARLSEEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggccttgtgctttcctcatggtcttgatggtgatgagctactggtcaacctgt
tctctaggatgtgacctgcctcagagtcataacttcaggaacaagagaaccttgacactc
ctggtacaaatgaggagactctccccnctctcctgcctgaaggacaggaaggactttgga
ttcccccaggagaaggtggatgcacagcagatccaggaggctcaagccatccctgtcctg
agtgagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcaactctcctagactcattctgcaatgacctccaccagcatctcaatgacctgcaa
ggctgtctgatacagcaggtgggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtctacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagactgagtgaggaggagtga

KEGG   Mus pahari (shrew mouse): 110323408
Entry
110323408         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323408
   04151 PI3K-Akt signaling pathway
    110323408
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323408
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323408
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323408
   04621 NOD-like receptor signaling pathway
    110323408
   04622 RIG-I-like receptor signaling pathway
    110323408
   04623 Cytosolic DNA-sensing pathway
    110323408
   04650 Natural killer cell mediated cytotoxicity
    110323408
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323408
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323408
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323408
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323408
   05161 Hepatitis B
    110323408
   05160 Hepatitis C
    110323408
   05171 Coronavirus disease - COVID-19
    110323408
   05164 Influenza A
    110323408
   05162 Measles
    110323408
   05168 Herpes simplex virus 1 infection
    110323408
   05163 Human cytomegalovirus infection
    110323408
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323408
   05169 Epstein-Barr virus infection
    110323408
   05165 Human papillomavirus infection
    110323408
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323408
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323408
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110323408
NCBI-ProteinID: XP_021056273
Ensembl: MGP_PahariEiJ_G0028487
LinkDB
Position
6
AA seq 190 aa
MARLCAFLMVLVVMSYWSTCSLGCDLLQSHNLRYKRALTLLVQMRRLSPISCLKDRKDFG
FPQEKVDAQQIQETQAIPVLSELTQQVLNIFTSKESSGAWNATLLDSFCNDLHQHLNDLQ
GCLMQQVGVQEPPLTQEDSLMAVRKYFHRITVYLKEKKHSPCAWEVIRAEIWRALSSSAK
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcaaggctctgtgctttcctgatggtcctggtggtgatgagctactggtcaacctgc
tctctaggatgtgacctgcttcagagtcataacctcaggtacaagagagccttgacactc
ttggtacaaatgaggagactctcccccatctcctgcctgaaggacaggaaggactttgga
ttcccccaggagaaggtggatgcccagcagatccaggagactcaagccatccctgtcctg
agtgagctgacccagcaggtcctgaacatcttcacatcaaaggagtcatctggagcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcatctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaggaacctccactgacccaggaagactccctt
atggctgtgaggaaatacttccacaggatcactgtgtacctgaaagagaagaaacacagc
ccctgtgcctgggaggtgatcagagcagaaatctggagagccctgtcttcctcagccaag
ttgctagcaagactgagtgaggagaaggagtga

KEGG   Mus pahari (shrew mouse): 110323416
Entry
110323416         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-12-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323416
   04151 PI3K-Akt signaling pathway
    110323416
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323416
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323416
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323416
   04621 NOD-like receptor signaling pathway
    110323416
   04622 RIG-I-like receptor signaling pathway
    110323416
   04623 Cytosolic DNA-sensing pathway
    110323416
   04650 Natural killer cell mediated cytotoxicity
    110323416
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323416
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323416
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323416
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323416
   05161 Hepatitis B
    110323416
   05160 Hepatitis C
    110323416
   05171 Coronavirus disease - COVID-19
    110323416
   05164 Influenza A
    110323416
   05162 Measles
    110323416
   05168 Herpes simplex virus 1 infection
    110323416
   05163 Human cytomegalovirus infection
    110323416
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323416
   05169 Epstein-Barr virus infection
    110323416
   05165 Human papillomavirus infection
    110323416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323416
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323416
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110323416
NCBI-ProteinID: XP_021056286
Ensembl: MGP_PahariEiJ_G0028481
LinkDB
Position
6
AA seq 190 aa
MARLCAFLMVLVVLSYWSTCSLGCDLPQTHNLRNKRALTLLVKMKRLPPLSCLKDRKDFR
FPQEKVDAQQIKKAQAIPVLSELTQQVLNIFTSKESSAAWNATLLDSFCNDLHQHLSDLQ
GCLMQQLGMQKSPLTQEDSQMAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSFSAK
LLERLSQEEE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggtcctggtggtgttgagctactggtcaacctgc
tctctaggatgtgaccttcctcaaactcataacctcaggaacaaaagagctttgacactc
ctggtaaaaatgaagagactcccccctctctcctgcctgaaggacagaaaggactttaga
ttcccccaggagaaggtggatgcccagcagatcaagaaggctcaagccatccctgtcctg
agtgaactgacccagcaggtcctgaacatcttcacatcaaaggagtcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcatctcagtgacctgcaa
ggctgtctgatgcagcagctgggaatgcagaaaagtcccctgacccaggaagactcccag
atggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtctttctcagccaag
ttgctggaaagactgagtcaggaggaggaatga

KEGG   Mus pahari (shrew mouse): 110323424
Entry
110323424         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-7-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323424
   04151 PI3K-Akt signaling pathway
    110323424
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323424
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323424
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323424
   04621 NOD-like receptor signaling pathway
    110323424
   04622 RIG-I-like receptor signaling pathway
    110323424
   04623 Cytosolic DNA-sensing pathway
    110323424
   04650 Natural killer cell mediated cytotoxicity
    110323424
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323424
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323424
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323424
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323424
   05161 Hepatitis B
    110323424
   05160 Hepatitis C
    110323424
   05171 Coronavirus disease - COVID-19
    110323424
   05164 Influenza A
    110323424
   05162 Measles
    110323424
   05168 Herpes simplex virus 1 infection
    110323424
   05163 Human cytomegalovirus infection
    110323424
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323424
   05169 Epstein-Barr virus infection
    110323424
   05165 Human papillomavirus infection
    110323424
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323424
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323424
SSDB
Motif
Pfam: Interferon DUF4569 MAS20
Other DBs
NCBI-GeneID: 110323424
NCBI-ProteinID: XP_021056297
LinkDB
Position
6
AA seq 190 aa
MARLCAFLMVLVVMSYWSTCSLGCDLLQSHNLRNKRALILLAQMRRLSPLSCLKDRKEFE
FPQEKVDAQQIQEAQAIPVLSELTQQVLNIFTSKESSAAWNATLLDSFCNDIHQQLNDLQ
GCLMQQVGMQESLWIQEDSLMAVRKYFHRITVYLREKKHSACAWEVVRAEVWRALSFSAN
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcaaggctctgtgctttcctgatggtcctggtggtgatgagctactggtcaacctgc
tctctaggatgtgacctgcttcagagtcataacctcaggaacaagagagctttaatcctc
ctggcacaaatgaggagactctcccccctctcctgcctgaaggacaggaaagagtttgaa
ttcccccaggagaaggtggatgcccagcagatccaggaagctcaagccatccctgtcctg
agtgagctgacccagcaagtcctcaacatcttcacatcaaaggagtcatctgcagcttgg
aatgcaaccctcctagactcattctgcaatgacatccaccagcagctcaatgacctgcaa
ggctgtctgatgcagcaggttgggatgcaggaatctctctggatccaggaagattctctg
atggctgtgaggaaatacttccacagaatcactgtgtacctgagagagaagaaacacagt
gcctgtgcctgggaagtggtcagagcagaagtctggagagccctgtctttctcagctaac
ttgctggcaagactgagtgaggagaaggagtga

KEGG   Mus pahari (shrew mouse): 110323427
Entry
110323427         CDS       T05929                                 

Definition
(RefSeq) interferon alpha-7-like
  KO
K05414  interferon alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323427
   04151 PI3K-Akt signaling pathway
    110323427
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323427
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110323427
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323427
   04621 NOD-like receptor signaling pathway
    110323427
   04622 RIG-I-like receptor signaling pathway
    110323427
   04623 Cytosolic DNA-sensing pathway
    110323427
   04650 Natural killer cell mediated cytotoxicity
    110323427
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323427
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110323427
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110323427
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323427
   05161 Hepatitis B
    110323427
   05160 Hepatitis C
    110323427
   05171 Coronavirus disease - COVID-19
    110323427
   05164 Influenza A
    110323427
   05162 Measles
    110323427
   05168 Herpes simplex virus 1 infection
    110323427
   05163 Human cytomegalovirus infection
    110323427
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323427
   05169 Epstein-Barr virus infection
    110323427
   05165 Human papillomavirus infection
    110323427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323427
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323427
SSDB
Motif
Pfam: Interferon DUF4569 MAS20
Other DBs
NCBI-GeneID: 110323427
NCBI-ProteinID: XP_021056301
LinkDB
Position
6
AA seq 190 aa
MARLCAFLMVLVVMSYWSTCSLGCDLLQSHNLRNKRALILLAQMRRLSPLSCLKDRKEFE
FPQEKVDAQQIQEAQAIPVLSELTQQVLNIFTSKESSAAWNATLLDSFCNDIHQQLNDLQ
GCLMQQVGMQESLWIQEDSLMAVRKYFHRITVYLREKKHSACAWEVVRAEVWRALSFSAN
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcaaggctctgtgctttcctgatggtcctggtggtgatgagctactggtcaacctgc
tctctaggatgtgacctgcttcagagtcataacctcaggaacaagagagctttaatcctc
ctggcacaaatgaggagactctcccccctctcctgcctgaaggacaggaaagagtttgaa
ttcccccaggagaaggtggatgcccagcagatccaggaagctcaagccatccctgtcctg
agtgagctgacccagcaagtcctcaacatcttcacatcaaaggagtcatctgcagcttgg
aatgcaaccctcctagactcattctgcaatgacatccaccagcagctcaatgacctgcaa
ggctgtctgatgcagcaggttgggatgcaggaatctctctggatccaggaagattctctg
atggctgtgaggaaatacttccacagaatcactgtgtacctgagagagaagaaacacagt
gcctgtgcctgggaagtggtcagagcagaagtctggagagccctgtctttctcagctaac
ttgctggcaagactgagtgaggagaaggagtga

KEGG   Mus pahari (shrew mouse): 110323960
Entry
110323960         CDS       T05929                                 

Gene name
Ifne
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04622  RIG-I-like receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323960 (Ifne)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323960 (Ifne)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    110323960 (Ifne)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323960 (Ifne)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110323960 (Ifne)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110323960
NCBI-ProteinID: XP_021056999
Ensembl: MGP_PahariEiJ_G0028491
LinkDB
Position
6
AA seq 192 aa
MVHRQLPEMVLLLLASSTIFSLEPKRIPFQSRMNRESLQLLKPLPSSSVQQCLAHRKNFL
LPQQPVSPHQYQEGQVLAVLHEILQQIFTLFQIHGSMGIWEENHIEKVLAALHRQLEYVE
SLGGLNAAQKSGGSSAQNLRLQIKAYFKRIHDYLENQRYSSCAWIVVQMEIHRCMFFVFR
FTTWLSRQDLDP
NT seq 579 nt   +upstreamnt  +downstreamnt
atggttcacagacagctccccgaaatggtgttgctgctcttggcttcttccactatcttc
tctctagaaccgaaacggattcccttccaatcgaggatgaacagagaaagtctacaacta
ctgaaaccattgccaagctcgtcagtccagcagtgtctagcacacaggaagaatttcctg
cttcctcagcagcctgtgagtcctcaccagtaccaagagggacaggtgctggctgttctg
cacgagatccttcagcagatcttcacgctcttccagatacatgggtctatgggcatctgg
gaggaaaaccatatagaaaaagtcttagctgcgcttcaccggcagttggaatacgtggag
tcactgggcggactgaacgcagcgcagaagagtgggggctcgagtgcgcagaaccttagg
ttacagattaaagcctacttcaagaggatccacgattacttggaaaaccaaaggtacagc
agctgtgcctggatcgttgtccagatggaaatccaccgttgtatgttctttgtgttcaga
ttcacaacatggctgagcagacaagacctagacccttga

KEGG   Mus pahari (shrew mouse): 110325617
Entry
110325617         CDS       T05929                                 

Gene name
Il17d
Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04657  IL-17 signaling pathway
mpah04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110325617 (Il17d)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110325617 (Il17d)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110325617 (Il17d)
   04659 Th17 cell differentiation
    110325617 (Il17d)
   04657 IL-17 signaling pathway
    110325617 (Il17d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110325617 (Il17d)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110325617 (Il17d)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 110325617
NCBI-ProteinID: XP_021059382
Ensembl: MGP_PahariEiJ_G0030368
LinkDB
Position
8
AA seq 205 aa
MLGTLVWMLAVGFLLALAPGRAAGALRTGRRPARPRDCADRPEELLEQLYGRLAAGVLSA
FHHTLQLGPREQARNASCPAGGRAADRRFRPPTNLRSVSPWAYRISYDPARFPRYLPEAY
CLCRGCLTGLYGEEDFRFRSTPVFSPAVVLRRTAACAGGRSVYAEHYITIPVGCTCVPEP
DKSADSANSSMDKLMLGPADRPAGR
NT seq 618 nt   +upstreamnt  +downstreamnt
atgttggggacactggtctggatgctcgcggtcggcttcctgctggcgctggcgccgggc
cgcgcggcgggcgcgctgaggaccgggaggcgcccggcgcggccgcgggactgcgcggac
cggccggaggagctcctggagcagctgtacgggcggctggcggccggcgtgctcagcgcc
ttccaccacacgctgcagctcgggccgcgcgagcaggcgcgcaatgccagctgcccggcc
gggggcagggccgccgaccgccgcttccggccgcccaccaacctgcgcagcgtgtcgccc
tgggcgtacaggatttcctacgaccccgctcgctttccgaggtacctgcccgaagcttac
tgcctgtgccgaggctgcctgaccgggctctacggggaggaggacttccgctttcgcagc
acacccgtcttctctccagccgtggtgctgcggcgcacggcggcctgcgcgggcggccgc
tctgtgtacgccgaacactacatcaccatcccggtgggctgcacctgcgtgcccgagccg
gacaagtccgcggacagtgcgaactccagcatggacaagctgatgctggggcccgccgac
aggcctgcggggcgctga

KEGG   Mus pahari (shrew mouse): 110326932
Entry
110326932         CDS       T05929                                 

Gene name
Ifng
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03050  Proteasome
mpah04060  Cytokine-cytokine receptor interaction
mpah04066  HIF-1 signaling pathway
mpah04217  Necroptosis
mpah04350  TGF-beta signaling pathway
mpah04380  Osteoclast differentiation
mpah04612  Antigen processing and presentation
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05164  Influenza A
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    110326932 (Ifng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110326932 (Ifng)
   04630 JAK-STAT signaling pathway
    110326932 (Ifng)
   04066 HIF-1 signaling pathway
    110326932 (Ifng)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110326932 (Ifng)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110326932 (Ifng)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110326932 (Ifng)
   04612 Antigen processing and presentation
    110326932 (Ifng)
   04660 T cell receptor signaling pathway
    110326932 (Ifng)
   04658 Th1 and Th2 cell differentiation
    110326932 (Ifng)
   04659 Th17 cell differentiation
    110326932 (Ifng)
   04657 IL-17 signaling pathway
    110326932 (Ifng)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110326932 (Ifng)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326932 (Ifng)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110326932 (Ifng)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110326932 (Ifng)
   05323 Rheumatoid arthritis
    110326932 (Ifng)
   05321 Inflammatory bowel disease
    110326932 (Ifng)
   05330 Allograft rejection
    110326932 (Ifng)
   05332 Graft-versus-host disease
    110326932 (Ifng)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110326932 (Ifng)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110326932 (Ifng)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110326932 (Ifng)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110326932 (Ifng)
   05164 Influenza A
    110326932 (Ifng)
   05168 Herpes simplex virus 1 infection
    110326932 (Ifng)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110326932 (Ifng)
   05144 Malaria
    110326932 (Ifng)
   05145 Toxoplasmosis
    110326932 (Ifng)
   05140 Leishmaniasis
    110326932 (Ifng)
   05142 Chagas disease
    110326932 (Ifng)
   05143 African trypanosomiasis
    110326932 (Ifng)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mpah03051]
    110326932 (Ifng)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110326932 (Ifng)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110326932 (Ifng)
Proteasome [BR:mpah03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110326932 (Ifng)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110326932 (Ifng)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110326932 (Ifng)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 110326932
NCBI-ProteinID: XP_021061252
Ensembl: MGP_PahariEiJ_G0031245
LinkDB
Position
9
AA seq 155 aa
MNATRCILALQLFLMAVSGCYCHGTLIESLESLKNYFNSSSIDVEEKSLFLDIWRNWQKD
GDTKILESQVISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFE
VDNPQIQRKAVSELIRVIHQLSPESSLRKRKRSRC
NT seq 468 nt   +upstreamnt  +downstreamnt
atgaacgctacacgctgcatcttggctttgcagctcttcctcatggctgtttctggctgt
tactgccacggcacactcattgaaagcctagaaagtctgaagaactattttaactcaagt
agcatcgatgtggaagaaaagagcctcttcttggatatctggaggaactggcaaaaggat
ggtgacacgaaaatacttgagagccaggttatctctttctacctcagactctttgaagtc
ttgaaggacaaccaggccatcagcaacaacataagcgtcattgaatcacacctgattact
aacttcttcagcaacagtaaggcgaaaaaggatgcgttcatgagtatcgccaagtttgag
gtagacaacccacagatccagcgcaaagccgtcagcgagctcatcagagtgatccaccag
ctgtcgccagaatccagcctcaggaagcggaaaaggagtcggtgctga

KEGG   Mus pahari (shrew mouse): 110326940
Entry
110326940         CDS       T05929                                 

Gene name
Il22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04659  Th17 cell differentiation
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110326940 (Il22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110326940 (Il22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110326940 (Il22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    110326940 (Il22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110326940 (Il22)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110326940 (Il22)
SSDB
Motif
Pfam: IL22 IL10 BshC IL28A
Other DBs
NCBI-GeneID: 110326940
NCBI-ProteinID: XP_021061261
Ensembl: MGP_PahariEiJ_G0031246
LinkDB
Position
9
AA seq 179 aa
MAVLQKSMSFSLMGTLAASCLLLMALWAQEADALPINTQCKLEVSNFQQPYIVNRTFMLA
KEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVP
FLTKLSSQLSPCRISGDDQQIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
NT seq 540 nt   +upstreamnt  +downstreamnt
atggctgtcctgcagaaatctatgagcttctcccttatggggactttagccgccagctgc
ctgcttctcatggccctgtgggcccaggaggcagatgcgctgcccatcaacacccagtgc
aaacttgaggtgtccaacttccagcagccgtacatcgtcaaccgcacctttatgctggcc
aaggaggccagccttgcagataacaacacagatgtccggctcatcggggagaaactgttc
cgaggagtcagtgctaaggatcagtgctacctcatgaagcaggtgctcaacttcaccctg
gaagatgttctgctcccccagtcagatcgattccagccctacatgcaggaggtggtacct
ttcctgaccaaactcagcagtcagctcagcccctgtcgcatcagcggtgatgaccaacag
atccagaagaacgtcagaaggctgaaggagacagtgaaaaagcttggagagagcggagag
atcaaagcgatcggggaactggatctgctgtttatgtctctgagaaatgcctgcgtctga

KEGG   Mus pahari (shrew mouse): 110327099
Entry
110327099         CDS       T05929                                 

Gene name
Il23a
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04659  Th17 cell differentiation
mpah05133  Pertussis
mpah05152  Tuberculosis
mpah05200  Pathways in cancer
mpah05321  Inflammatory bowel disease
mpah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110327099 (Il23a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110327099 (Il23a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110327099 (Il23a)
   04659 Th17 cell differentiation
    110327099 (Il23a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327099 (Il23a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110327099 (Il23a)
   05321 Inflammatory bowel disease
    110327099 (Il23a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110327099 (Il23a)
   05152 Tuberculosis
    110327099 (Il23a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110327099 (Il23a)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110327099 (Il23a)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 110327099
NCBI-ProteinID: XP_021061480
Ensembl: MGP_PahariEiJ_G0031155
LinkDB
Position
9
AA seq 196 aa
MLDCRVVILLWLLPWVTQGLAVPRSSGPDWAQCQQLSQSLCTLAWNAHAPAGHVDLLREE
EEEETKNNVPRIQCGDGCDPEGLKDNSQLCLQRIHHGLAFYKHLLDSDIFKGEPALLPDS
PVEQLHTSLLGLSQLLQPEDHPRETQQMPSLSPSQQWQRPLLRSKILRSLQAFLAIAARV
FAHGAATLTEPLVPTA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgctggattgcagagtggtaatactgctatggctgttgccctgggtcactcagggcctg
gctgtgcctaggagtagcggtcctgactgggctcagtgccaacagctctctcagagtctc
tgcacactagcctggaacgcacatgcaccagcaggacatgtggatctactaagagaagag
gaggaggaagagactaaaaacaatgtgccccgtatccagtgtggagacggttgtgaccca
gaaggactcaaggacaacagccagctctgcttgcaaaggatccaccacggtctggctttt
tataagcacctgttggactcagacatcttcaaaggggagcctgctctactccctgatagc
cccgtggaacaacttcacacctccctactgggcctcagccaactcctccagccagaggat
cacccccgggagacccaacagatgcccagcctgagtcccagtcagcagtggcagcgcccc
cttctccgttccaagatcctccgaagcctccaggcctttttggccatagccgcccgggtc
tttgcccacggagcagcaactctgactgaacccttagtgccaacagcttaa

KEGG   Mus pahari (shrew mouse): 110330418
Entry
110330418         CDS       T05929                                 

Gene name
Ifnl1
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon lambda-1
  KO
K05447  interferon lambda 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110330418 (Ifnl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110330418 (Ifnl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110330418 (Ifnl1)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110330418 (Ifnl1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 110330418
NCBI-ProteinID: XP_021066142
LinkDB
Position
1
AA seq 207 aa
MGDALHKWVRTKAEDTKVCLLGLVTMVLGLATAGPVPXSKPTPTGSGCHIGSFQSLSQRE
LDAFKEAKEALEESLRKDIGCNTNPFPSAWDLGQQQVQERPKALQAEVALTLKVWENMTD
SALATILGQPLRTLSHIHSQLQTCTQPQPTAEPRPPSRRLSRWLHRLQEAQSKETPGCLE
ASVTLNLFRLLTRDLKCVASGDQCVRD
NT seq 624 nt   +upstreamnt  +downstreamnt
atgggggatgccctccataagtgggtgagaaccaaagcagaagacacaaaagtgtgcctg
ctgggtctggtgaccatggtgctgggcttggccactgctggtcctgtccctncttccaag
cccaccccaaccggatcaggctgtcacattggtagtttccagtctctgtcacaacgggag
ctggatgcctttaaggaagccaaggaggcgttagaagaatcgcttcggaaggacattggg
tgcaacaccaacccctttcccagtgcctgggacctgggccagcagcaggtccaggagcgc
cccaaggccttgcaggctgaggtggccctgacactgaaggtctgggagaacatgactgac
tcagccctggccaccatcctgggccagcctcttcgcacactgagccacatccactcccag
ctgcagacctgtacacagcctcagcccacagcagagcccaggcccccgagccgccgcctc
tcccgctggctacacaggctccaggaggcccagagcaaggagacccctggctgcctggag
gcctctgtcaccctcaacctctttcgcctgctcacccgggacctcaagtgtgtggccagt
ggagaccagtgtgtcagagattag

KEGG   Mus pahari (shrew mouse): 110330430
Entry
110330430         CDS       T05929                                 

Definition
(RefSeq) interferon lambda-2
  KO
K22669  interferon lambda 2/3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110330430
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110330430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110330430
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110330430
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 110330430
NCBI-ProteinID: XP_021066169
LinkDB
Position
1
AA seq 206 aa
MFLLLLLLAKVLTRTQADPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKTAKDAIERRL
LEKDVRCSSHLFPRAWDVKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLRTL
SHIHSQLQTCTQPQPTAEPRPPSRRLSRWLHRLQEAQSKETPGCLEASVTLNLFRLLTRD
LKCVASGDQCLFASGNLTCVCLLAPV
NT seq 621 nt   +upstreamnt  +downstreamnt
atgttcctcctcctgctgctgctggccaaggtgctgacaagaacccaagctgaccctgtc
cccagggccaccaggctcccagtggaagcaaaggattgccacattgctcagttcaagtcc
ctgtcccccaaggagctgcaggccttcaaaacggccaaggacgccattgaaaggaggctg
cttgagaaggatgtgaggtgcagctcccacctcttccccagggcctgggacgtgaagcag
ctgcaggtccaggagcgccccaaggccttgcaggctgaggtggccctgacactgaaggtc
tgggagaacatgactgactcagccctggccaccatcctgggccagcctcttcgcacactg
agccacatccactcccagctgcagacctgtacacagcctcagcccacagcagagcccagg
cccccgagccgccgcctctcccgctggctacacaggctccaggaggcccagagcaaggag
acccctggctgcctggaggcctctgtcaccctcaacctctttcgcctgctcacccgggac
ctcaagtgtgtggccagtggagaccagtgtctgttcgcatctggaaacctcacctgtgtc
tgtctccttgccccggtgtag

KEGG   Mus pahari (shrew mouse): 110330793
Entry
110330793         CDS       T05929                                 

Gene name
Lif
Definition
(RefSeq) leukemia inhibitory factor isoform X1
  KO
K05419  leukemia inhibitory factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04630  JAK-STAT signaling pathway
mpah04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110330793 (Lif)
   04668 TNF signaling pathway
    110330793 (Lif)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110330793 (Lif)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110330793 (Lif)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110330793 (Lif)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110330793 (Lif)
SSDB
Motif
Pfam: LIF_OSM PRF
Other DBs
NCBI-GeneID: 110330793
NCBI-ProteinID: XP_021066773
Ensembl: MGP_PahariEiJ_G0016858
LinkDB
Position
13
AA seq 202 aa
MKVLAAGIVPLLLVLHWKHGAGSPLPITPVNATCATRHPCHGNLMNQIKNQLAQLNGSAN
ALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHANGTEKTRLVELYRMVAYMSASLANIT
RDQKVLNPTAVSLRVKLNATIDVMRGLLSNVLCRLCNKYHVGHVDVPPVPDHSDKEAFQR
KKLGCQLLGTYKQVISVVVQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggctgcagggattgtgcccttactgctggttctgcactggaaacacggg
gcagggagtccccttcccatcacccctgtaaatgccacctgtgccacacgccacccatgc
cacggcaacctcatgaaccagatcaagaatcaactggcacagctcaatggcagcgccaat
gctctcttcatttcctattacacagctcaaggggagccgtttcccaacaatgtggaaaag
ctatgtgcgcctaacatgacagacttcccatctttccatgccaacgggacggagaagacc
aggttggtggagctgtatcggatggtcgcatacatgagtgcatccctggccaatatcacc
cgggatcagaaggtcctgaaccccactgccgtgagcctccgggtcaagctcaatgctact
atagacgtcatgaggggcctcctcagcaatgtgctttgccgtctgtgcaacaagtaccat
gtgggccatgtggatgtgccacctgtccctgaccactctgacaaagaagccttccaaagg
aaaaagttgggttgccagctcctggggacgtacaagcaagtcataagcgtggtggtccag
gccttctag

KEGG   Mus pahari (shrew mouse): 110330998
Entry
110330998         CDS       T05929                                 

Gene name
Osm
Definition
(RefSeq) oncostatin-M
  KO
K05418  oncostatin M
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110330998 (Osm)
   04151 PI3K-Akt signaling pathway
    110330998 (Osm)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110330998 (Osm)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110330998 (Osm)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110330998 (Osm)
SSDB
Motif
Pfam: LIF_OSM PGBA_N
Other DBs
NCBI-GeneID: 110330998
NCBI-ProteinID: XP_021066970
Ensembl: MGP_PahariEiJ_G0016859
LinkDB
Position
13
AA seq 264 aa
MQTQLPRTLLSLTLSLLFLSMALAKRGCSTSSPQLFSQLQNQANFTRNTDSLLEPYIRLQ
NLNTDDLRAACIQQHSVAFPSEDTLRQLSKPHFLSTVYATLGRVLYQLDALRQKLLKTQA
FPQLEGTRQNIQGIRNNVYCMAQLLNYSLEIPEPTQADSGASRSTTAPSVFQTKMAGCGF
LWEYHRFMGSVGRVLREWFDGSRRSRRQCPLLARRKRTRRIRVRRKGTRRIRVRRKGTRR
IRVRRKGARKIRPSRSTQSPTTRA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgcagacacagcttccaagaacactgctcagtttgaccctcagtctccttttcctgagc
atggcactggccaagcgtggctgctccacctcgtcccctcagctcttcagccagctgcag
aatcaggcgaacttcacgaggaacacggactcactcttggagccctatatccgcctccaa
aacttgaacacagatgacctgagagctgcctgcatacagcagcactctgtggccttcccc
agtgaggacacactccggcaactgagcaagcctcacttcctgagcactgtgtacgccaca
ctgggcagagtcttgtaccaactggatgctttaagacagaaacttctgaagactcaggct
tttccacagctggaggggacccggcagaatatccagggcataaggaacaatgtttactgc
atggcccagctgctcaactactccctggagatacctgagcccacacaggcggactctggg
gcctcacggtccactacagcaccgagtgtctttcagaccaagatggctggctgtggcttc
ctctgggaataccatcgcttcatgggctcagtggggagggtcttaagggaatggttcgat
ggctccagacgcagccggagacagtgcccgctcctggcccggcgcaagagaacccgcaga
atccgggtccggcgcaagggaacccgcagaatccgggtccggcgcaagggaacccgcaga
atccgggtccggcgcaagggagcccgcaaaattagaccttccaggagcacccagagcccg
acgaccagggcctag

KEGG   Mus pahari (shrew mouse): 110332403
Entry
110332403         CDS       T05929                                 

Gene name
Il12b
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04620  Toll-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04940  Type I diabetes mellitus
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05162  Measles
mpah05164  Influenza A
mpah05168  Herpes simplex virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05321  Inflammatory bowel disease
mpah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332403 (Il12b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332403 (Il12b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110332403 (Il12b)
   04622 RIG-I-like receptor signaling pathway
    110332403 (Il12b)
   04625 C-type lectin receptor signaling pathway
    110332403 (Il12b)
   04658 Th1 and Th2 cell differentiation
    110332403 (Il12b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332403 (Il12b)
   05205 Proteoglycans in cancer
    110332403 (Il12b)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110332403 (Il12b)
   05330 Allograft rejection
    110332403 (Il12b)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110332403 (Il12b)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110332403 (Il12b)
   05134 Legionellosis
    110332403 (Il12b)
   05152 Tuberculosis
    110332403 (Il12b)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110332403 (Il12b)
   05164 Influenza A
    110332403 (Il12b)
   05162 Measles
    110332403 (Il12b)
   05168 Herpes simplex virus 1 infection
    110332403 (Il12b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110332403 (Il12b)
   05145 Toxoplasmosis
    110332403 (Il12b)
   05140 Leishmaniasis
    110332403 (Il12b)
   05142 Chagas disease
    110332403 (Il12b)
   05143 African trypanosomiasis
    110332403 (Il12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332403 (Il12b)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332403 (Il12b)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110332403 (Il12b)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110332403 (Il12b)
SSDB
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_2 fn3 ig I-set
Other DBs
NCBI-GeneID: 110332403
NCBI-ProteinID: XP_021069281
Ensembl: MGP_PahariEiJ_G0017366
LinkDB
Position
14
AA seq 335 aa
MCPPKLTISWFAMVLLVSPLMAMWELEKDVYVVEVDWSPDAPGETVNLTCDTPEEDDITW
TSDQRRGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF
KNKTFLKCEAPNYSGRFTCSWLVQRNIDLKFNIKSSSSSPDSRAVTCGTASLSAEKVTLN
QRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSASFFIRDIIKPDPPKNLQ
MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS
TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtgtcctccgaagctaaccatctcctggtttgccatggttttgctggtgtctccactc
atggccatgtgggagctggagaaagatgtttatgttgtagaggtggactggagtcccgat
gcccctggagaaacagtgaacctcacctgtgacacgcctgaagaagatgacatcacctgg
acctcagaccagagacgtggagtcataggctctggaaagaccctgaccatcactgtcaaa
gagtttctagatgctggccagtacacctgccacaaaggaggcgagactctgagccactcg
catctgctgctgcacaagaaggaaaatgggatttggtccactgagattttaaaaaatttc
aaaaacaagactttcctgaagtgtgaggcaccaaattactccggacggttcacgtgctcg
tggctggtgcaaagaaacattgacttgaagttcaatatcaagagcagtagcagttcccct
gactctcgggcagtgacatgtggaacagcgtctctgtctgcagagaaggtcacactgaac
caaagggactatgagaagtactccgtgtcctgccaggaggatgtcacctgcccaactgcc
gaggagaccctgcccattgaactggcattggaggcacggcagcagaataaatatgagaac
tacagcgccagcttcttcatcagggacatcatcaaaccagacccgcccaagaacttgcag
atgaagcctttgaagaactctcaggtggaggtcagctgggagtaccctgactcctggagc
actccccattcctacttctccctcaagttcttcgttcgaatccagcgcaagaaagaaaag
atgaaggagacagaggaggggtgtaaccagaaaggtgcattcctcgtagagaagacatct
actgaagtccaatgcaaaggcgggaatgtctgtgtgcaagctcaggatcgctactacaat
tcctcgtgcagcaagtgggcatgtgtgccctgcagggtccgatcctag

KEGG   Mus pahari (shrew mouse): 110332438
Entry
110332438         CDS       T05929                                 

Gene name
Csf2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04650  Natural killer cell mediated cytotoxicity
mpah04657  IL-17 signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah05146  Amoebiasis
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05171  Coronavirus disease - COVID-19
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
mpah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332438 (Csf2)
   04668 TNF signaling pathway
    110332438 (Csf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332438 (Csf2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332438 (Csf2)
   04650 Natural killer cell mediated cytotoxicity
    110332438 (Csf2)
   04660 T cell receptor signaling pathway
    110332438 (Csf2)
   04657 IL-17 signaling pathway
    110332438 (Csf2)
   04664 Fc epsilon RI signaling pathway
    110332438 (Csf2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110332438 (Csf2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110332438 (Csf2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110332438 (Csf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110332438 (Csf2)
   05171 Coronavirus disease - COVID-19
    110332438 (Csf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110332438 (Csf2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110332438 (Csf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110332438 (Csf2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332438 (Csf2)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332438 (Csf2)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     110332438 (Csf2)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110332438 (Csf2)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110332438 (Csf2)
SSDB
Motif
Pfam: GM_CSF DUF3937
Other DBs
NCBI-GeneID: 110332438
NCBI-ProteinID: XP_021069332
Ensembl: MGP_PahariEiJ_G0017489
LinkDB
Position
14
AA seq 141 aa
MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDGTPVTLNEEVEVVSNE
FSFKRLTCVQTRLKIFEQGLRGNFVKLKGALNMTASYYQTYCPPTSESDCELQVTTFADF
IDSLKTFLTGIPLECEKTVRK
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtggctgcagaatttacttttcctgggcattgtggtctacagcctctcagcacccacc
cgctcacccatcactgtcacccggccttggaagcatgtagaggccatcaaagaagccctg
aacctcctggatggcacgcctgtcacattgaacgaagaggtagaagttgtctctaacgag
ttctccttcaagaggctaacatgtgtgcagacccgcctgaagatattcgagcagggtcta
cggggcaattttgtcaaactcaagggcgccttgaacatgacagccagctactaccagacg
tactgccccccaacctcggaatctgactgtgaattacaagtcaccacctttgcggatttc
atagacagccttaaaacctttctgactggtatccccttagaatgcgaaaaaacagtccga
aaatga

KEGG   Mus pahari (shrew mouse): 110332614
Entry
110332614         CDS       T05929                                 

Gene name
Il5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah05200  Pathways in cancer
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332614 (Il5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332614 (Il5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332614 (Il5)
   04660 T cell receptor signaling pathway
    110332614 (Il5)
   04658 Th1 and Th2 cell differentiation
    110332614 (Il5)
   04657 IL-17 signaling pathway
    110332614 (Il5)
   04664 Fc epsilon RI signaling pathway
    110332614 (Il5)
   04672 Intestinal immune network for IgA production
    110332614 (Il5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332614 (Il5)
  09163 Immune disease
   05310 Asthma
    110332614 (Il5)
   05320 Autoimmune thyroid disease
    110332614 (Il5)
   05321 Inflammatory bowel disease
    110332614 (Il5)
   05330 Allograft rejection
    110332614 (Il5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332614 (Il5)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332614 (Il5)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110332614 (Il5)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110332614 (Il5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 110332614
NCBI-ProteinID: XP_021069557
Ensembl: MGP_PahariEiJ_G0017479
LinkDB
Position
14
AA seq 132 aa
MRMLLHLSVLTLSCVWTTAMEIPMSTVVKETLTQLSAHQALLTSNETMRLPVPTHKNHQL
CIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCVEERRRTKQFLDYLQEF
LGVMSTEWAMEG
NT seq 399 nt   +upstreamnt  +downstreamnt
atgaggatgcttctgcacttgagcgttctgactctgagctgtgtctggaccactgccatg
gagattcccatgagcacagtggtgaaagagaccttgacacaactgtccgctcaccaagct
ctgctgacaagcaacgagacgatgaggcttcctgtgcctactcataaaaatcaccagcta
tgcattggagaaatctttcaggggctagacatactgaagaatcaaactgtccgcgggggt
actgtggaaatgctattccaaaacttgtcattaataaagaaatacattgaccgccaaaaa
gagaagtgtgttgaggagagacggaggacgaagcagttcctggattacctacaagagttc
cttggtgtgatgagtacagagtgggcaatggaaggctaa

KEGG   Mus pahari (shrew mouse): 110332737
Entry
110332737         CDS       T05929                                 

Gene name
Il13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04664  Fc epsilon RI signaling pathway
mpah05200  Pathways in cancer
mpah05310  Asthma
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332737 (Il13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332737 (Il13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110332737 (Il13)
   04657 IL-17 signaling pathway
    110332737 (Il13)
   04664 Fc epsilon RI signaling pathway
    110332737 (Il13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332737 (Il13)
  09163 Immune disease
   05310 Asthma
    110332737 (Il13)
   05321 Inflammatory bowel disease
    110332737 (Il13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332737 (Il13)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110332737 (Il13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 110332737
NCBI-ProteinID: XP_021069735
Ensembl: MGP_PahariEiJ_G0017477
LinkDB
Position
14
AA seq 131 aa
MALWVTAVLALACLGGLATPGPVPRSVSLPLALKELIEELSNITQDQAPLCNGSMVWSVD
LAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVPSLPDTKIEVAHFITKLLS
YTKQLFRHGPF
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgctctgggtgactgcagtcctggctctcgcttgccttggtggtctcgccacccca
gggccagtgccgagatccgtgtctctccctctggcccttaaggagctcattgaggagctg
agcaacatcacacaagaccaggctcccctgtgcaacggcagcatggtatggagtgtggac
ctggcagctggcgggttctgtgtagccctggattccctgaccaacatctccaattgcaat
gccatctacaggacccagaggatattgcatggcctctgtaaccgcaaggcccccactacg
gtccccagcctccctgataccaagatcgaagtagcccactttataacaaaactgctcagc
tacacaaagcaactgtttcgccacggccccttctaa

KEGG   Mus pahari (shrew mouse): 110332758
Entry
110332758         CDS       T05929                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-3-like
  KO
K04736  interleukin 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04664  Fc epsilon RI signaling pathway
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
mpah05310  Asthma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332758
   04151 PI3K-Akt signaling pathway
    110332758
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332758
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110332758
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332758
   04664 Fc epsilon RI signaling pathway
    110332758
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332758
   05202 Transcriptional misregulation in cancer
    110332758
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110332758
  09163 Immune disease
   05310 Asthma
    110332758
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332758
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332758
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110332758
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110332758
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 110332758
NCBI-ProteinID: XP_021069762
Ensembl: MGP_PahariEiJ_G0017490
LinkDB
Position
14
AA seq 178 aa
MVLASSTTCIHSMLPLLLMLFHQGLQASISGQDTRHLTRPLNCSSIAKEIMGKLPVTSXF
FLSMSPQGSELNNTDQRAKLKDKTLRRVNLYKFLESQEKLDPNDKFGIKSNLQKLKCCLP
ASVNDSKLPGVLFQDLNDFQKKLRFYVVHLKNLQTVLTSRPPQPASGSVSLNPGVVEC
NT seq 537 nt   +upstreamnt  +downstreamnt
atggttcttgccagctctaccacctgcatccactccatgctgcccctgctcctgatgctc
ttccaccagggactccaagcttcaatcagtggccaggacacccgccatttaaccagacca
ttgaattgcagctctattgccaaggagattatggggaagctcccagtgacctcatgattc
tttctctctatgtccccacagggatctgaactcaataacactgatcaaagagccaagctg
aaggacaagaccttgcggagagtaaacctttacaaattcctggaaagccaagagaaattg
gatcctaacgataaattcggcatcaagtccaatcttcagaaacttaagtgttgcctgcct
gcatctgtgaatgactctaagctgccaggggtcttgtttcaagatctgaatgactttcag
aagaaattgagattctacgtggtccatcttaaaaatctgcagacagtgctaacctctaga
ccacctcagcccgcatctggctccgtctctcttaatcctggagtcgtggaatgttaa

KEGG   Mus pahari (shrew mouse): 110332760
Entry
110332760         CDS       T05929                                 

Gene name
Il4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah05140  Leishmaniasis
mpah05200  Pathways in cancer
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332760 (Il4)
   04151 PI3K-Akt signaling pathway
    110332760 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332760 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332760 (Il4)
   04660 T cell receptor signaling pathway
    110332760 (Il4)
   04658 Th1 and Th2 cell differentiation
    110332760 (Il4)
   04659 Th17 cell differentiation
    110332760 (Il4)
   04657 IL-17 signaling pathway
    110332760 (Il4)
   04664 Fc epsilon RI signaling pathway
    110332760 (Il4)
   04672 Intestinal immune network for IgA production
    110332760 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332760 (Il4)
  09163 Immune disease
   05310 Asthma
    110332760 (Il4)
   05320 Autoimmune thyroid disease
    110332760 (Il4)
   05321 Inflammatory bowel disease
    110332760 (Il4)
   05330 Allograft rejection
    110332760 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110332760 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332760 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332760 (Il4)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110332760 (Il4)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110332760 (Il4)
SSDB
Motif
Pfam: IL4 Rif1_N
Other DBs
NCBI-GeneID: 110332760
NCBI-ProteinID: XP_021069763
Ensembl: MGP_PahariEiJ_G0017476
LinkDB
Position
14
AA seq 142 aa
MGLRPQLAVILLFFLECTGNRIHGCNDKHLKEIINILNQVTGEGTPCLEMVVPDIFTARK
NTTESELICRASKVLRTFYLEHEILPCLKKNFSVLAQLQRLFRAMRCAKLPKSCTLNESA
LTSLKDFLESLKNIVQMDYSQY
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtctcaggccccagctagctgtcatcctgctcttctttctcgagtgtaccgggaac
cgtatccacggatgcaacgacaaacacttgaaagagatcatcaacattttgaaccaggtc
acaggagaagggacgccatgcctcgagatggtcgtgccagacatctttacagcaaggaag
aacaccacggagagcgagctcatctgtagggcttccaaggtgcttcgcacattttattta
gaacatgagatacttccgtgtttgaagaagaactttagtgttctcgcccagctgcagaga
ctctttcgggccatgagatgcgcgaagctaccgaaaagctgcaccctgaatgagtccgcg
ctcacatcattgaaagacttcctggaaagcctaaaaaacatcgtgcaaatggattactcg
cagtactga

KEGG   Mus pahari (shrew mouse): 110333517
Entry
110333517         CDS       T05929                                 

Gene name
Tslp
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110333517 (Tslp)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110333517 (Tslp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110333517 (Tslp)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110333517 (Tslp)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 110333517
NCBI-ProteinID: XP_021070737
Ensembl: MGP_PahariEiJ_G0018812
LinkDB
Position
15
AA seq 138 aa
MVLLRNLFILQAVQMVLTYNFSNCNFESISEIYCEVIFRDLESDLNGAKFDQIEDCESKS
ACLLKIEYYSLNPIPGCPSLPEKAFARRTRAALSNHCPGYSETERNGTQEMAQEVQHICL
NQTSQILRLWYSFMQSPQ
NT seq 417 nt   +upstreamnt  +downstreamnt
atggttcttctcaggaacctcttcatcttgcaagcggtacagatggtgctaacttacaac
ttttctaactgtaacttcgagtcaatttcggaaatatattgtgaagtaatttttcgtgac
ctggaaagtgatctgaatggggccaagttcgaccaaatcgaggactgtgaaagcaagtca
gcttgtctcctgaaaatcgagtactattctctcaatcctatccctggctgcccttcactc
cctgagaaagcattcgcccggagaacaagagctgccctcagtaaccactgcccaggctac
tctgaaactgagagaaacggtactcaggaaatggcacaagaagtccaacacatctgcctg
aatcaaacctcacaaattctaagattgtggtattccttcatgcaatctccacaataa

KEGG   Mus pahari (shrew mouse): 110334313
Entry
110334313         CDS       T05929                                 

Gene name
Il9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah05310  Asthma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110334313 (Il9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110334313 (Il9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110334313 (Il9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110334313 (Il9)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110334313 (Il9)
SSDB
Other DBs
NCBI-GeneID: 110334313
NCBI-ProteinID: XP_021071793
Ensembl: MGP_PahariEiJ_G0019649
LinkDB
Position
16
AA seq 144 aa
MLVTYILASVLLFNSVLGQKCSTTWGIRDTSYLIEKLKDDPLSKCSCSGNVTSCLCLSVP
TDDCTTPCYQEGLSQVTNATQKTRFSPIFFRVKRIVEVLKNSKCPFFSCERPCNQTAAGN
TLSFLKSLLGTFQKAEVQVQKSLP
NT seq 435 nt   +upstreamnt  +downstreamnt
atgttggtgacatacatccttgcctctgttttgctcttcaattctgtgctgggccagaaa
tgcagcaccacatggggcatcagagacaccagttaccttattgaaaagctgaaggatgat
ccactgtcaaaatgcagctgcagcggcaacgtgaccagctgcttgtgtctctctgtccca
actgatgattgtaccacaccgtgctaccaggagggactgtcacaggtgaccaatgccaca
cagaaaacaagattctcgcctattttctttcgggtgaaaaggatagttgaagtcctaaag
aacagcaagtgtccgttcttttcctgcgaaaggccatgcaaccagaccgcggcaggcaac
acactgtcatttctgaagagtctcctggggacattccagaaggcagaggtgcaagttcag
aaaagcctaccatga

KEGG   Mus pahari (shrew mouse): 110337120
Entry
110337120         CDS       T05929                                 

Gene name
Il11
Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110337120 (Il11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110337120 (Il11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110337120 (Il11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    110337120 (Il11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110337120 (Il11)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110337120 (Il11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 110337120
NCBI-ProteinID: XP_021075536
Ensembl: MGP_PahariEiJ_G0020996
LinkDB
Position
19
AA seq 199 aa
MNCVCRLVLVVLSLWPDRVFAPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQM
RDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLR
TLEPELGALQARLERLLRRLQLLMSRLALPQATPDQPVAPLGPPASAWGSIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgtcgcctggtcctggtggtgctgagcctctggccagatagagtcttt
gcccctgggccaccagctggctcccctcgggtctcttcagaccctcgtgcagatctggac
agcgccgttctcctaacccgatccctcctggcagacacacggcaactagctgcacagatg
agagacaaattcccagctgatggagatcacaatctggactccctgcctaccttggccatg
agcgctgggacattgggatctttgcagcttcctggtgtgctgacaaggcttcgagtagac
ttgatgtcctacctcaggcatgtacaatggctgcgccgcgcaggtggtccttccctaagg
actctggagccagagctgggtgccctgcaagcccgactggaacggctactccgtcgttta
cagctcttgatgtctcgcctggccttgccccaggccaccccagaccaacctgtggccccc
ctgggccctcctgcctcagcctggggaagcatccgggcagctcatgccatcttaggaggg
ctgcacctgaccttggactgggccgtgcggggcctgctgttgttaaagacgcggctgtga

KEGG   Mus pahari (shrew mouse): 110337630
Entry
110337630         CDS       T05929                                 

Gene name
Il15
Definition
(RefSeq) interleukin-15 isoform X1
  KO
K05433  interleukin 15
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04668  TNF signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110337630 (Il15)
   04668 TNF signaling pathway
    110337630 (Il15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110337630 (Il15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    110337630 (Il15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110337630 (Il15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110337630 (Il15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110337630 (Il15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110337630 (Il15)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110337630 (Il15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 110337630
NCBI-ProteinID: XP_021076300
Ensembl: MGP_PahariEiJ_G0022866
LinkDB
Position
20
AA seq 162 aa
MKILKPYMRNTSISCYLCFLLNSHFLTEAGIHVFILGCVSVVLPKTEANWIDVRYDLEKI
ESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANS
TLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaaaattttgaaaccatatatgaggaatacatccatctcgtgctacttgtgtttcctt
ctaaacagtcactttttaaccgaggctggcattcatgtcttcattttgggctgtgtcagt
gtagttctccctaaaacagaggccaactggatagatgtaagatatgacctggagaaaatt
gaaagccttattcaatctattcatattgacaccactttatacaccgacagtgactttcat
cccagttgcaaagttactgcaatgaactgctttctcctggaattgcaggttattttacac
gagtacagtaacatgactcttaatgaaacagtgagaaacgtgctctaccttgcaaacagc
actctgtcttctaacaagaatgtagcagaatctggctgcaaggaatgtgaggaactggag
gagaaaaccttcacggagtttttgcaaagctttatacgcattgtccaaatgttcatcaac
acgtcctga

KEGG   Mus pahari (shrew mouse): 110338822
Entry
110338822         CDS       T05929                                 

Gene name
Ifnk
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04622  RIG-I-like receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338822 (Ifnk)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110338822 (Ifnk)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    110338822 (Ifnk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110338822 (Ifnk)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interferons
   110338822 (Ifnk)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110338822
NCBI-ProteinID: XP_021077939
Ensembl: MGP_PahariEiJ_G0024011
LinkDB
Position
22
AA seq 199 aa
MTSKYLWLVALVALSIPPIQSLNCVHLDDAILQNVKLLGSIMTGFPLRCLKDITDFKFPK
EILPYIQHMDKEINAISYRISALALTIFNLKGSISPVAEEHWERIRSGLFEQVRQARECF
MDEEKENREHPPSEDLLMVYLELSKYFLRIKKFLINKKYSFCAWKIVTVEIRRCFTIFYK
SKKLLKMISESPTFKQELK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgacttcaaagtacttatggctagtggcccttgtggctctatccattccgcccatccag
tctctgaactgtgttcacctggatgatgccatcttgcaaaatgtgaaacttctgggcagt
atcatgaccggctttcccttaagatgtctaaaagatatcacggatttcaagtttcctaaa
gagattttgccatacatccagcatatggataaggagataaacgccatctcctatcgtata
tctgctctggcactaactatcttcaatcttaaaggctccatctctccggtggcagaggaa
cactgggaacgtatcagatcgggactttttgaacaagtgcggcaagctcgagagtgtttc
atggacgaggagaaagagaacagggagcatcctccctccgaggacttactgatggtctac
ctggaattgagcaagtatttcttaagaatcaaaaagttcttgataaataagaaatacagc
ttctgcgcgtggaagattgtcacggtggagataagaagatgtttcactatattttacaag
tctaaaaaactactcaaaatgatatcagaatcacccaccttcaagcaagaacttaaatag

DBGET integrated database retrieval system