KEGG   Oryctolagus cuniculus (rabbit): 100328903
Entry
100328903         CDS       T03373                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04611  Platelet activation
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100328903 (RASGRP2)
   04014 Ras signaling pathway
    100328903 (RASGRP2)
   04015 Rap1 signaling pathway
    100328903 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100328903 (RASGRP2)
   04062 Chemokine signaling pathway
    100328903 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100328903 (RASGRP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100328903 (RASGRP2)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100328903 (RASGRP2)
SSDB
Motif
Pfam: RasGEF EF-hand_1 EF-hand_6 C1_1 EF-hand_7 EF-hand_5 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 100328903
NCBI-ProteinID: NP_001164963
UniProt: B7NZH9
LinkDB
Position
Un
AA seq 609 aa
MACTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSSSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSNLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPLELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFIALFNSVSQWVQLMVLGKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHLSADTIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPAVLLEPWTSAAKPKLD
QALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREE
MVSYFLRSSSVLGGRMGFVHSFQESNSLRPVACRHCKTLILGIYKQGLKCRACGVNCHKQ
CKDRLSVECRRRAQSVSLEGPAASPSPTHSHHRAFSFSLPRPGRRGSRPPEIREEEVQAV
EDGVFDIHL
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggcgtgcaccctggacctggacaagggctgcacggtggaggagctgctccgcggctgc
atcgaagcctttgacgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctt
atgatgcatccctggtacatcccctcctctcagctggcggccaaactgctccacatctac
caacagtcccggaaggacaactccagttccctgcaggtgaaaacctgccacctggtcagg
tactggatctccgcgttcccggcggagttcgacttgaacccggagctggccgagcagatt
aaagagctgaaggctctcctggaccaagaagggaaccgacggcacagcaacctcattgac
atcgacagcgtccccacctacaagtggaagcggcaggtgacccagcggaacccggtggga
cagaaaaagcgcaagatgtcgctgctgttcgaccacctggagcccctggagctggcggaa
cacctcacctacctggagtaccgctccttctgcaagatcctgttccaggactaccacagc
ttcgtgactcacggctgcaccgtggacaaccccgtgctggagagattcatcgccctcttc
aacagcgtctcccagtgggtgcagctcatggtcctcggcaagcccaccgcgccccagcgg
gccctggtcatcacgcacttcgtccacgtggcagagaagctgctgcagctgcagaacttc
aacacgctgatggccgtggtcgggggcctgagccacagctccatctcgcggctcaaggag
acccacagccacctcagcgccgacaccatcaagctctgggaagggctgaccgaattagtg
acggccacaggcaactatggcaactaccggcggcgtctggcagcctgcgtgggcttccgc
ttccccatcctgggtgtgcacctcaaggacctggtggccctgcagctggcactgcccgac
tggctggaccccgcgcggacacggctcaacggggccaagatgaagcagctgttcagtatc
ctggaggagctggccatggtgaccagcctgcggccacccgtgcaagccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccagctg
tccctgcagcgggagccgcgctccaagtcttcgccaaccagccccaccagttgcacgccg
cctccacggcccgctgtgctcctggagccgtggacctccgctgctaagcccaagctggac
caggccctggtggtggaacacattgagaagatggtggagtctgtgttccggaacttcgat
gttgacggcgacggccatatctcgcaggaagagttccagatcatccgtggaaatttccct
tacctcagcgcctttggggacctcgaccagaaccaggacggctgcatcagcagggaggag
atggtctcctacttcctgcgctccagctccgtgctgggcggccgcatgggcttcgtgcac
agcttccaggaaagcaactccttgcgcccagtcgcctgccgccactgcaaaaccctgatc
cttggtatctacaagcagggcctgaaatgcagagcctgcggcgtgaattgccacaagcag
tgcaaggaccgcctgtcggtggagtgccggcgcagggcccagagtgtgagtctggagggg
cccgcggcctccccctctcccacacacagccaccaccgcgccttcagcttctccctgccc
cggccgggcaggcgaggttcccggcctccagagatacgagaggaggaggtgcaggcggtg
gaggacggggtgtttgacatccacttgtga

KEGG   Oryctolagus cuniculus (rabbit): 100342183
Entry
100342183         CDS       T03373                                 

Gene name
RASGRP3
Definition
(RefSeq) RAS guanyl releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04662  B cell receptor signaling pathway
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100342183 (RASGRP3)
   04014 Ras signaling pathway
    100342183 (RASGRP3)
   04015 Rap1 signaling pathway
    100342183 (RASGRP3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    100342183 (RASGRP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342183 (RASGRP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100342183 (RASGRP3)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100342183 (RASGRP3)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 RasGEF_N
Other DBs
NCBI-GeneID: 100342183
NCBI-ProteinID: XP_002709817
Ensembl: ENSOCUG00000015439
LinkDB
Position
2
AA seq 690 aa
MGSSGLGKAATLDELLSACIEMFDDSGELNDSCLPRIVLLMHRWYLSSTELAEKLLCMYR
NADGESCDDFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHISLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKSFADCDGFKIP
ILGVHLKDLIAVHVIFPDWMEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSPTSPTTPNKPVVPLEWASGVMPKPDPTVINKHI
RKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRA
KSQLHCKMGPGFVHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLV
LACRRLARAPSLGSSHGSLPGSPSIPPVQDDVFEFPGVAAGHQDLDSRAITLVTGSSRKI
SVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVQ
AGVDVVDRGTEFEPDQDEGQDETRQDGEDG
NT seq 2073 nt   +upstreamnt  +downstreamnt
atggggtcaagtggacttgggaaagcagcgacattggatgaactgctgagcgcttgcatt
gagatgtttgatgacagtggggagctaaatgatagttgcttgcccagaatagttctactg
atgcaccgatggtatttatcttccaccgaattggcagaaaagcttctctgcatgtatcgc
aatgctgatggagaaagctgtgatgactttcgattaaagatctgctacttcatgaggtac
tggattctcaagttcccggcagagttcaatttggatcttggtttgattcgtatgactgaa
gagttccgagaagtagctagtcaactgggatatgaaaaacacatcagcctcatcgatata
tccagcattccttcctatgactggatgagaagagtcactcagaggaaaaaagtatccaag
aagggaaaagcctgtctgctgtttgaccatctggagcccattgaattggctgagcacctc
acttttctggagcataaatcttttagaaggatctcattcaccgattaccaaagctatgtt
atccatggctgcctggagaataacccaaccttggagagatctattgctttatttaatggc
atctcgaagtgggtccaattgatggttctcagcaaaccaaccccacagcaaagggcagaa
gtgatcacaaagtttatcaatgttgcaaagaagctccttcagctcaaaaattttaatacc
ctgatggcggtggtaggaggcctcagccatagttccatttcacgtctcaaagagactcat
tcccatctttcttcagaagttaccaagaactggaatgaaatgacagagctggtctcctcc
aatggcaattactgcaattaccgcaagtcctttgccgactgcgatggcttcaaaatcccc
atccttggagtccacttgaaagacttgatagcggtccatgtcattttcccagactggatg
gaggagaacaaagtgaacattgtaaaaatgcaccagctgtccgttaccctgagtgaactg
gtgtccctgcagaatgcctctcaccacttagaacccaacatggatttgatcaacctgctc
acgctctctctggacctctatcacacagaagatgatatttacaaactatcactggtgctg
gagcctagaaattcaaaatcacctacctccccgactacacccaacaagcctgtggtaccc
ctggagtgggcatcaggagtgatgccaaagccggaccccacagtcatcaacaagcacata
aggaaattagttgagtctgtgtttagaaactatgatcacgaccatgatgggtacatctcc
caagaggactttgaaagtatagcagccaattttccctttttggattccttctgtgtgctg
gacaaagatcaagatggcttgatcagtaaagacgaaatgatggcttacttcctgagagct
aaatcccaactacactgtaaaatgggaccaggatttgtccataattttcaagagatgacc
tacctgaagccaaccttctgtgaacactgtgcaggatttctctggggcataatcaagcaa
ggatacaaatgcaaagactgtggagccaattgtcacaaacagtgcaaagacctcctggtt
ctggcctgcaggagactggcccgggcaccctccttggggagtagtcatgggtcactgcca
ggaagcccctcaatacccccagtgcaggatgatgtatttgagtttcctggggttgctgct
ggacatcaggacctggacagcagagccatcacactggtcacaggctcttcccgcaagatc
tctgtgaggttacagcgggccaccaccagccaggccacccagactgaacctgtttggtcg
gaggctggctggggggattcaggatcccacaccttccccaaaatgaaatccaagttccat
gacaaagccgcaaaggacaaaggttttgccaagtgggaaaacgagaagcccagggtacag
gctggagtggatgttgttgatcggggcaccgagtttgaacctgaccaggatgaaggccag
gatgagaccagacaggatggtgaggatggctga

KEGG   Oryctolagus cuniculus (rabbit): 100350559
Entry
100350559         CDS       T03373                                 

Gene name
RASGRP4
Definition
(RefSeq) RAS guanyl releasing protein 4
  KO
K12363  RAS guanyl-releasing protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100350559 (RASGRP4)
   04014 Ras signaling pathway
    100350559 (RASGRP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100350559 (RASGRP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100350559 (RASGRP4)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100350559 (RASGRP4)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_7 EF-hand_6 RasGEF_N EF-hand_1
Other DBs
NCBI-GeneID: 100350559
NCBI-ProteinID: XP_017197696
Ensembl: ENSOCUG00000000305
LinkDB
Position
5
AA seq 675 aa
MNRKDSKRKSHQECTGKPGGRGHPRPARRHKTCPSPREISKVMASLHLGILSEGGCSEEE
LLEQCIQCFDSAGSLRRGDHVLNMALAMHSWVLPSADLAARLLTSYPSGKPKYQKATGDT
QELRRLQICHLVRYWLAQHPEALHQEPHLEEVISRFWATVARDGNSAQRSLRDSNLLSPG
GPGPPPPMNSPGLSKKRKVSLLFDHLEARELAQHLTYLEFRSFQAITPQDLRDYVLQGSV
RGCPALEGSVAFSNSVSRWVQVMVLSRPGPAQRAQVLDKFIQVAQWLRQLQNFNTLMAVT
GGLCHSAISRLKDSHTHLSPDSTKALLELTELLSSRNNYAHYRRTWVDCRGFRLPILGVH
LKDLVSLHEAQPDRLPDGRLHLHKLNSLYLRLQELAALQGQRPPYSANEDLLHLLTLSLD
LFYTEDEIYELSYAREPRCPKNLPPSPFKAPLVVEWAPGVMPKPDKATLGRHVEQLVESV
FKNYDPEGRGTISQEDFERLSGNFPFACHGLHPPPCQGSGSFSREELTGYLLRASAICAK
LGLAFLHTFHEVTFRRPTFCDSCSGFLWGVIKQGYRCRDCGLCCHKHCRDQVKVECKKRP
GAKGDVGPPGAPVPPTSVPHASCGSEENLSYTLSLEAETGCHFRHAWTQTESPHPSWDPE
TGTTPPATPSPKPDP
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgaacaggaaagacagcaagaggaagtctcaccaggaatgcaccgggaagccagggggg
cggggtcacccccgccccgcccgccgccacaagacgtgcccgagcccgcgggagatcagc
aaggtcatggcttccctgcatctgggcatactgagtgagggtggctgcagcgaggaggag
ctgctggagcaatgcatccagtgcttcgactcagcgggcagcctgcgccgcggagaccac
gttctcaacatggcgctggccatgcacagctgggtgctgccttccgccgaccttgctgcc
cggctgctgacctcatatccttctgggaaacccaagtaccagaaggccacaggggacaca
caggagctgaggcggctacagatctgtcacctggtcaggtactggctggcccagcaccca
gaggcactgcaccaagaaccccatctggaagaggttatcagccgtttctgggccacagtg
gcccgggatggcaactcggcccagaggagcctgcgagactccaacctcctgagccctggt
ggtcccggccccccgccgcccatgaacagcccaggcctgagcaaaaagcgcaaagtatcc
ttgctcttcgaccacctggaggccagggagctggcccagcacctcacctacctggagttc
cgctccttccaggccatcacgccccaggacctgcgggactacgttttgcagggctcggtg
cggggctgcccggccctggaggggtccgtggctttcagcaacagcgtgtcccgctgggtg
caggtcatggtgctgagccgccccgggcccgcgcagcgcgcgcaggtgttggacaagttc
atccaggtggcacagtggctccgccagctgcagaacttcaacaccctgatggcagtcacg
gggggcctgtgtcacagcgccatctccagactcaaggactcccacacccacttgagcccg
gacagcaccaaggccctgctggagctgaccgagctcctctcctcccgcaacaattacgcc
cattaccgccgcacctgggtcgactgccgaggcttccggctgcccatactgggtgtgcac
ctcaaggacctggtgtccctgcacgaggcacagcccgacaggttgcctgacggccgtctg
cacctgcacaaactgaacagcctctacctgcggctgcaagagctggcagccctccagggg
cagcgtccgccctacagtgccaacgaggaccttttgcacctgctcacgctttccctggat
ctcttctacacggaagacgagatctacgagctttcttatgcccgggagccccgctgtccc
aagaatctgccaccctcccccttcaaagcacccctggtggtggagtgggcccctggtgtg
atgcccaagccagacaaggccactctgggacggcacgtggagcagctggtggagtctgtg
ttcaagaactatgaccccgaaggccgaggaaccatctctcaggaggactttgagcggctc
tcaggcaacttcccctttgcctgccatggccttcacccacctccctgccaagggagcggc
tccttcagcagagaggagctgaccgggtacctgctccgggccagcgccatctgcgccaag
ctgggcctggccttcctgcacaccttccacgaggtcaccttccgcaggcccaccttctgt
gacagctgcagcggcttcctctggggtgtcatcaagcaaggctaccgctgtcgggactgc
gggctgtgttgccacaaacactgcagggaccaagtgaaagtggagtgcaagaagaggcca
ggagccaagggcgatgtggggcccccaggggcccccgtcccacccacctcagtcccccat
gccagctgtggttcagaggaaaatctctcctacacgctttccctggaagccgagactggg
tgccactttcgccacgcctggacccagacggagtccccacacccgtcctgggacccagag
acggggacgaccccgccggccaccccatcacccaagccggacccctag

KEGG   Oryctolagus cuniculus (rabbit): 100359319
Entry
100359319         CDS       T03373                                 

Gene name
RASGRP1
Definition
(RefSeq) RAS guanyl releasing protein 1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04611  Platelet activation
ocu04660  T cell receptor signaling pathway
ocu05200  Pathways in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100359319 (RASGRP1)
   04014 Ras signaling pathway
    100359319 (RASGRP1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100359319 (RASGRP1)
   04660 T cell receptor signaling pathway
    100359319 (RASGRP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100359319 (RASGRP1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100359319 (RASGRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100359319 (RASGRP1)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100359319 (RASGRP1)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_1 EF-hand_7 RasGEF_N EF-hand_5 EF-hand_8 Cep57_CLD_2 SPARC_Ca_bdg bZIP_1 DivIC UPF0242
Other DBs
NCBI-GeneID: 100359319
NCBI-ProteinID: XP_002718034
Ensembl: ENSOCUG00000001788
UniProt: A0A5F9CT19
LinkDB
Position
17
AA seq 798 aa
MGTLGKAREAPRKPSHGCRAGPKARLEAKPPASSPLPSHPSLAQITQFRMMVSLGHLAKG
ASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIIISSADLLQKVIALYKDALAKNSP
GLCLKICYFVRYWITEFWIMFKMDASLTHTMEEFQELAKARGEDLHCRLIDTTQINARDW
SRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVK
ENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIG
GLCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHL
KDLISLYEAMPDYLEDGKVNVHKLLALYNHINELVQLQEVAPPLDANKDLVHLLTLSLDL
YYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVF
KNYDHDQDGYISQEEFEKIAASFPFSFCVMDRDREGLISRDEITAYFMRASSIYSKLGLG
FPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPA
APTENSISVGPVSNLCSLGAKDLLHAPEEGPFAFPNGEVLEHSEESKDRTIMLMGVSSQK
ISVRLKRTVAHKATQTEALPWSGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLV
RKRAFVKWENKESLIKSKEELRRLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESL
QLEKSSHVLAQMEQSDCS
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgggcacgctgggcaaggcgagagaggctccgcggaaaccttcccatggctgcagagct
ggcccaaaagcgagactagaggcgaagccaccagccagcagccctctcccttcccatccc
agcctggcccagatcacccagttccgaatgatggtttctctgggacacttagccaaagga
gccagcctggacgatctcattgacagctgcattcaatcttttgatgcggatggaaacctg
tgtcggagcaaccagctgctgcaagtcatgctgaccatgcaccggattatcatctcctct
gcggacctgctccagaaagtcatcgccctctataaggatgccttggcgaagaactcacct
gggctttgcctgaagatctgctattttgtaaggtactggataacagaattctggatcatg
tttaaaatggacgccagcctgacacacaccatggaggagtttcaggagctggcgaaagct
cgcggagaggatctccactgccgcctgattgacacaactcagatcaatgcccgtgactgg
tccaggaaacttactcaacggataaagtcaaacaccagcaagaaacggaaggtgtccctg
ctgttcgaccacctggagccggaagagctgtctgagcacctcacctaccttgagttcaag
tccttccgcaggatatccttctcggactatcaaaattaccttgtaaatagctgtgtgaag
gagaaccccaccatggagcggtccattgccctgtgcaacggcatctcccagtgggtgcag
ctgatggttctcagccggcccaccccgcagctccgagcagaggtgttcatcaagttcata
caggtggctcagaagctccaccaactacagaacttcaatacgctgatggctgtgataggt
gggctgtgtcacagctccatctccagactcaaggagaccagctcgcatgtcccacatgaa
atcaataaggttctgggtgagatgactgagctactgtcctcctgcagaaactatgacaac
taccggcgagcctatggcgagtgcacccatttcaagatccccatcctgggggtgcacctc
aaggacctcatctccctgtatgaagctatgcccgactatctggaagatgggaaggtcaat
gtccacaagctgctggccctttacaatcacatcaatgaactggtccagcttcaagaggtg
gccccgcccttggacgccaacaaggacttggtacacctgctaactttatccttggatctc
tactacaccgaagatgaaatctatgaactttcctatgcccgggaaccaagaaaccaccga
gccccgccactgacaccttcaaagcctccagtagtagtggactgggcctctggagtatct
cccaaacctgacccaaagaccattagcaaacacgtccagaggatggtggattctgtcttc
aagaactatgatcacgaccaggatgggtacatttctcaggaagagtttgagaagattgct
gccagctttccgttttccttctgtgtgatggatagagacagggaaggcctcatcagcaga
gacgagatcacagcctacttcatgagggccagttcaatctactccaagctgggtctgggc
tttcctcacaattttcaagagaccacctacctgaagcccactttctgtgacaactgtgct
ggatttctctggggagtgatcaaacaaggatatcgatgtaaagactgtgggatgaactgc
cacaaacaatgcaaagatctagtcgtgtttgagtgcaaaaagcgagctaagaacccagca
gctcccacagagaacagcatttctgtggggccagtgtccaacctttgctcactgggagcc
aaagatcttctccacgcacctgaggaaggacccttcgcatttcccaatggggaggtttta
gagcacagcgaggagagcaaggatcgaaccatcatgctgatgggagtgtcctcacagaag
atttctgtgcgactgaaaaggactgttgcccacaaggccacccagacggaagcgttgcct
tggagtgggagtgagggtccttctgggccctttgtgctgtcttctccaaggaagacagcg
caggatactctgtatgtgcttcccagtcccacatctccatgccccagcccagtcttggtc
agaaagagggcttttgtcaagtgggagaataaagaatccctcataaaatccaaggaggaa
ctacggcgactaagacttccaacctaccaagagctggaacaggaaatcaataccctgaaa
gcagataacgatgctctaaagatccaactgaagtacgcacagaagaaaatagaatccctg
cagcttgaaaaaagcagtcatgtcttagctcagatggagcagagtgattgttcttag

DBGET integrated database retrieval system