KEGG   Oryctolagus cuniculus (rabbit): 100346449
Entry
100346449         CDS       T03373                                 

Gene name
RALB
Definition
(RefSeq) RAS like proto-oncogene B
  KO
K07835  Ras-related protein Ral-B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100346449 (RALB)
   04015 Rap1 signaling pathway
    100346449 (RALB)
   04072 Phospholipase D signaling pathway
    100346449 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346449 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100346449 (RALB)
   05212 Pancreatic cancer
    100346449 (RALB)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    100346449 (RALB)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    100346449 (RALB)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 AAA_25 Gtr1_RagA AAA_24 FeoB_N
Other DBs
NCBI-GeneID: 100346449
NCBI-ProteinID: XP_002712402
Ensembl: ENSOCUG00000005992
LinkDB
Position
7
AA seq 206 aa
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLLFSITEHESFTATAEFREQILRVKSEEDK
IPLLVVGNKSDLEERRQVPVEEARSKADEWGVQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKEKNGKKSSKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcgaacaagagcaagggccagagctccttggccctgcacaaggtgatcatggtc
ggcagtggaggggtcggcaagtcggccctgacgcttcagttcatgtacgacgagtttgtg
gaagactacgagcccacgaaggccgacagctacaggaagaaagtggttctggacggcgag
gaggtgcagatagacatcctggacacggccggccaggaggactacgcggccattcgagac
aactacttccggagtggggaaggcttcctgctgctgttctccatcaccgagcacgagtcc
ttcacggccacggctgagttcagggaacagatcctccgcgtgaagtcggaagaagataag
atcccgctgctggtggtgggcaacaagtccgacctggaggagcggaggcaggtgcccgtc
gaggaggctcggagcaaagcggacgagtggggcgtgcagtacgtggagacctcggcgaag
acgcgggccaatgtggacaaggtgttctttgacctcatgagagagatccgagccaagaag
atgtcggaaaacaaggagaagaacggcaagaaaagcagcaagaacaagaagagctttaaa
gagaggtgttgcttgctgtga

KEGG   Oryctolagus cuniculus (rabbit): 100354283
Entry
100354283         CDS       T03373                                 

Gene name
RALA
Definition
(RefSeq) RAS like proto-oncogene A
  KO
K07834  Ras-related protein Ral-A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu05132  Salmonella infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100354283 (RALA)
   04015 Rap1 signaling pathway
    100354283 (RALA)
   04072 Phospholipase D signaling pathway
    100354283 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354283 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100354283 (RALA)
   05212 Pancreatic cancer
    100354283 (RALA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100354283 (RALA)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    100354283 (RALA)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    100354283 (RALA)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF ATP_bind_1
Other DBs
NCBI-GeneID: 100354283
NCBI-ProteinID: XP_002713814
Ensembl: ENSOCUG00000016581
UniProt: G1TBX7
LinkDB
Position
10
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaataagcccaagggtcagaattctttggccttacacaaagtcatcatggtg
gggagtggtggcgtgggcaagtctgctctgactctgcagttcatgtatgatgagtttgtg
gaggactatgagcccaccaaagcagacagctatcgcaagaaagtagtgctggatggggag
gaagtacagatcgacatcttagatacagcggggcaggaggactatgctgccatccgagac
aactacttccggagcggggagggtttcctctgtgtcttctctattacggaaatggaatcc
tttgcagccacagccgacttcagggagcagatcctaagagtaaaagaagatgagaatgtt
ccatttctgctggttggtaacaaatcagatttagaagataaaaggcaggtttccgtagaa
gaggcaaagaaccgagcggaccagtggaatgttaactacgtggaaacatctgctaaaacg
cgggctaatgttgacaaggtattttttgatttaatgagggaaattcgagccagaaagatg
gaagacagcaaagaaaagaatgggaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system