Ochotona princeps (American pika): 101536496 Help Entry 101536496         CDS       T07609                                  Symbol IL18 Name (RefSeq) interleukin-18   KO K05482   interleukin 18 Organism opi  Ochotona princeps (American pika) Pathway opi04060   Cytokine-cytokine receptor interaction opi04061   Viral protein interaction with cytokine and cytokine receptor opi04621   NOD-like receptor signaling pathway opi04623   Cytosolic DNA-sensing pathway opi05132   Salmonella infection opi05134   Legionellosis opi05135   Yersinia infection opi05143   African trypanosomiasis opi05144   Malaria opi05152   Tuberculosis opi05164   Influenza A opi05321   Inflammatory bowel disease opi05323   Rheumatoid arthritis opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101536496 (IL18)    04061 Viral protein interaction with cytokine and cytokine receptor     101536496 (IL18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101536496 (IL18)    04623 Cytosolic DNA-sensing pathway     101536496 (IL18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101536496 (IL18)   09171 Infectious disease: bacterial    05132 Salmonella infection     101536496 (IL18)    05135 Yersinia infection     101536496 (IL18)    05134 Legionellosis     101536496 (IL18)    05152 Tuberculosis     101536496 (IL18)   09174 Infectious disease: parasitic    05144 Malaria     101536496 (IL18)    05143 African trypanosomiasis     101536496 (IL18)   09163 Immune disease    05323 Rheumatoid arthritis     101536496 (IL18)    05321 Inflammatory bowel disease     101536496 (IL18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101536496 (IL18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:opi04052]     101536496 (IL18) Cytokines and neuropeptides [BR:opi04052]  Cytokines   Interleukins    101536496 (IL18) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 PAC4 Motif Other DBs NCBI-GeneID:  101536496 NCBI-ProteinID:  XP_012782370 LinkDB All DBs Position 1:complement(32695830..32744123) Genome browser AA seq 139 aa AA seqDB search MASFCKQQFGTVERIPEPTEEDCINFVAMKFTDNTLYFISENDDNLESDYFGKLEPRISI IRNLNDQVLFVDQEKKPLFEDMPDSDCTDNGPQTTFIIHIYKDSYARGMAVTLSVKNKKI LTLSCENKIISFKMLHLED NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggcttccttttgcaagcaacaatttggcacagtagagaggattcctgagccaacagaa gaggattgcatcaattttgtggcaatgaaatttactgacaacacactttactttataagt gaaaatgatgacaatctggagtcggattacttcggcaaacttgaaccaagaatctccatc atacggaatttgaatgaccaagttctcttcgttgaccaagagaaaaagcctctgtttgag gatatgcctgattctgactgtacagataatgggccccaaaccacttttataatacacata tataaagacagctatgctagaggcatggctgtaaccctctctgtgaagaataagaaaatt cttactctctcctgtgagaataaaattatttcctttaagatgttacatttagaagattaa

DBGET integrated database retrieval system