KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343113Help
Entry
4343113           CDS       T01015                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4343113
   00051 Fructose and mannose metabolism
    4343113
   00052 Galactose metabolism
    4343113
   00500 Starch and sucrose metabolism
    4343113
   00520 Amino sugar and nucleotide sugar metabolism
    4343113
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4343113
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343113
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4343113
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4343113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 4343113
NCBI-ProteinID: XP_015645221
UniProt: Q8LH82
LinkDB All DBs
Position
7
AA seq 498 aa AA seqDB search
MAAAAVAADQKVVTMTSLREGCACAAPPAAAAPPMPKMAAAQRVVAELREACATPAARLA
EVAAAMAGEMEAGLAVEGGSSEMKMIVSYVDSLPTGGEEGSYYALDLGGTNFRVLRVRLA
GGGVAERVAREVPIPPGLMSGGGATSECLFGFIASALAEFVGEEEEEGGLDGGERELGFT
FSFPVHQTSIASGTLIRWTKAFAVDDAIGEDVVAALQAAMSERGLDMRVSALINDTVGTL
AAGSYYDEDVVAAVILGTGTNAAYVEDATAIAKLHPSQLPASNTMVINTEWGSFASPCLP
LTEFDEALDQESLNPGEQTYEKLISGMYLGEIVRRVLLKISSRCPSLLGGAGELATPFVL
RTPDVSAMHHDETPDLSIVGEKLERTLGIRGTSPEARRMVVEVCDIVATRAARLAAAGIV
GILKKIGRVDGGEGRRRRSVVAVDGGLFEHYGKFRRCMESAVRELLGEAAAERVVVKLAS
DGSGLGAALVAAAHSQRA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggtggcggcagatcagaaggtggtgacgatgacgagcctccgggag
ggctgcgcttgcgcggcgcctcctgctgcagctgcgccgccgatgccgaagatggcggcg
gcgcagagggtggtggcggagctgagagaagcgtgcgcgacgccggcggcgaggctggcg
gaggtggccgcggcgatggccggcgagatggaggccgggctggcggtggagggcggcagc
agcgagatgaagatgatcgtgtcgtacgtcgacagcctccccaccggcggcgaggagggg
tcgtactacgcgctcgacctcggcggcaccaacttccgcgtcctccgcgtgcggcttgcc
ggcggcggcgtcgccgagcgcgtggcgagggaggtcccgatccctcccggcctcatgtcc
ggcggcggcgccacctcggagtgcctcttcggcttcatcgcctccgcgctagccgagttc
gtcggcgaggaggaagaagaaggcggcctcgacggcggcgagagggagcttgggttcacc
ttctccttccccgtgcaccaaacctccatcgcgtcggggacgctcatccggtggacgaag
gcgttcgccgtcgacgacgcgatcggcgaggacgtcgtggcggcgctgcaggcggccatg
tcggagcgggggctcgacatgcgcgtgtcggcgctcatcaacgacaccgtcgggacgctc
gccgcgggcagctactacgacgaggacgtcgtggccgccgtcatcctcggcaccggcacg
aacgccgcctacgtcgaggacgccaccgccatcgccaagctacacccatcgcagctgcca
gcatcgaacaccatggtgatcaacaccgagtggggcagcttcgcctcgccgtgcctccca
ttgacggagttcgacgaagcactcgatcaggagagcctcaaccccggcgagcagacctac
gagaagctcatctccgggatgtacctcggcgagatcgtcaggagggtcctcctcaagatc
tcctcccggtgcccctccctcctcggcggcgccggcgagctcgcgacgccgttcgtcctc
aggacacccgacgtgtccgcgatgcaccacgacgagacgcccgacctgagcatcgtcggc
gagaagctggaacgcacgctgggcatccgcggcacgtcgccggaggcgaggaggatggtc
gtcgaggtgtgcgacatcgtcgccacgagggccgcccggctggccgcggcggggatcgtc
gggatcctgaagaagatcgggagggtcgacggcggcgaggggcggaggaggaggtcggtg
gtcgccgtggacggcgggctgttcgagcactacggcaagttccggcggtgcatggagagc
gcggtgagggagctgctcggagaggcggcggcggagagggtggtcgtcaagctcgccagc
gacggctccgggctcggcgccgccctggttgcagctgctcactcgcagagagcataa

DBGET integrated database retrieval system