KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108296Help
Entry
102108296         CDS       T02921                                 

Definition
(RefSeq) steroid 21-hydroxylase-like
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00140  Steroid hormone biosynthesis
phi01100  Metabolic pathways
Module
phi_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102108296
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:phi00199]
    102108296
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     102108296
Cytochrome P450 [BR:phi00199]
 Cytochrome P450, animal type
  CYP21 family
   102108296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 102108296
NCBI-ProteinID: XP_014116900
LinkDB All DBs
Position
Un
AA seq 508 aa AA seqDB search
MAAAALLLLLLLLLSSLSLAALLRRDDGRGPRWGALHLLHPQGALHLSRLARRHGPVLRL
RLGDRAPDAPPKTPTPGFTTWFGTPQFCGPPQLLLFPADVLVPSSVGTIREALVRHWGDW
LGRPTSYLGSLVSRGGRDLALGGPCPGWRRQRVAVRGALAQAGGRLGPLLWLQGQKLCEE
LRSHGEAPVDPFEVFTFHTCSTIARLLFGDLVSPPGELRAFSRCLGELLQVWGHSSVRAL
DLLPLLRALPNPGLRKLLQLVQHRDTFVEAQIQRHQACPSPPPDTVLGALLGHNSGARGG
SLSPPRLHMALVDLFIGGTETTAAALGWAVAFLLHRPELQARLRAELEGAHGPPGPGDMG
RLPLLQATVSETLRLRPPAPLALPHCALRHTSLGGLPVVAGTVLVPNLLAAQQDPDIWQN
PEVFLPERFLAPGAPSRSLLPFGCGARSCPGEGLARAELFVFLGLILREFRLEPGPGGLP
GLRGSPGTVLRCPPFRLRMVACQRSGSP
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcggcgctgctgctgttgctgctgctgttgctgtcgtcactgtcgctggcg
gcgctgctgcggcgggacgatgggcgcggcccgcgctggggggcgctgcacctcttgcac
ccgcagggggcgctgcacctgagccgcctggcgcggcggcacgggcccgtgctgcgcctg
cgcttgggggaccgcgctcccgacgctccacccaaaacccccaccccaggattcaccact
tggtttgggaccccccagttttgtggtcctcctcagctcctcctcttccctgcagatgtg
ctggtgccgagctcggtggggaccatccgtgaggcgctggtccggcactggggggactgg
ctgggccgccccaccagttatctggggtcgctggtgtcacgggggggccgggacctggca
ctgggaggcccctgccctggctggcggcggcagcgggtagcagtgcggggggcactggca
caggctggggggcgtctcgggcccctcctttggctgcagggccagaagttgtgtgaggag
ctgcgttcccatggggaggcccctgtggacccctttgaggtgttcaccttccatacctgc
agcaccatcgcacgcctcctctttggagacctggtgtcccctccaggggagctccgggcc
ttctcccgctgcttgggggagctgctgcaggtttgggggcacagcagcgtacgggcgctt
gatctgctgcccctgttgcgggccctgcccaacccaggattgaggaagctgctgcagctt
gtccagcaccgtgacaccttcgtggaggcccagatccagcggcaccaggcatgcccctcc
cctcccccagacacagttttgggggcactgctggggcataattctggggcacggggtggc
tccctgagccccccccggctgcacatggcgctggtcgacctgttcattgggggcactgag
accacggcggctgctctgggctgggctgtagccttcttgctgcatcgtcctgagctgcag
gcacggctgcgggcagagttggagggtgcacatggaccccctgggccgggggacatgggg
cgcctgccccttcttcaggccaccgtcagcgagactctgcggctgcggccccctgcacct
ctggcgctgccccactgcgccctgcgccataccagtcttggggggctccccgtggtggct
ggcaccgtcttggtccccaacctgctggcagcccaacaggaccctgacatctggcagaac
cctgaggtcttcctgcccgagcggttcctggccccgggcgccccctcgcggtcactgctg
ccgttcggctgcggggcgcgctcgtgcccgggggagggtctggcgcgggcggagctcttc
gtgttcctggggctgatcctgcgggaattccgtctggagccgggcccggggggactgccg
gggctgagggggtcgccgggtacggtgttgcgctgccccccctttcgcctgcgcatggtg
gcttgccagcgctcgggctcaccctga

DBGET integrated database retrieval system