KEGG   Parus major (Great Tit): 107198881
Entry
107198881         CDS       T04864                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04210  Apoptosis
pmaj04620  Toll-like receptor signaling pathway
pmaj04621  NOD-like receptor signaling pathway
pmaj04622  RIG-I-like receptor signaling pathway
pmaj04623  Cytosolic DNA-sensing pathway
pmaj04625  C-type lectin receptor signaling pathway
pmaj04920  Adipocytokine signaling pathway
pmaj05132  Salmonella infection
pmaj05164  Influenza A
pmaj05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107198881 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107198881 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107198881 (IKBKG)
   04621 NOD-like receptor signaling pathway
    107198881 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    107198881 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    107198881 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    107198881 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107198881 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107198881 (IKBKG)
  09172 Infectious disease: viral
   05164 Influenza A
    107198881 (IKBKG)
   05168 Herpes simplex virus 1 infection
    107198881 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107198881 (IKBKG)
Protein kinases [BR:pmaj01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107198881 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO TPD52
Other DBs
NCBI-GeneID: 107198881
NCBI-ProteinID: XP_015471623
LinkDB
Position
Unknown
AA seq 578 aa
MGEATPGGVTNQCSLPAALLWRCHDTYRSGSAVWRGDVTHFRRKREVAAPPGSLNSPNSA
QKSPNSASNRLRLARAPREPPMSGGRWRRPAEMVQPGPEADPALAEALQRLRAENRELRG
ALCHCTESLRQRLEELRKLQLQRRGERELLRGRWGQARDLVLHLRGQRRDSTGDTPRDTP
GDTRDTPGDTKDTPGDTKDTPGDVWDAKDTSGDIRDTLRDTRDISRDTPDTSTKPPEATP
CSVSLPLEDIPAVPEPPQAPSSTPLEPSSEEQLKQRLAEAEAELVTLRARVAVAELRAQD
VSRAAELQLQGLRRQLEQDKAQVQAQVTSLLGELRESQNRLERSRAEREHLERRARSDAE
RCQQLEEVTQGHQVQLDQLRLQVTNLETALRVERRGATEEKRKLVQLQAAYHHLFQEYDA
HIKASLEGDKRSQVTQEQLRAAEAALALKQDLIDHLKAEAERQRAALETIPVLQAQADIY
RADFEAERAAREQLHGQREALQEELNQLRLRLGGDGARARLEEMRNRHSEPPPAPVPGRG
FGGLLPPAEEGPDLCCPKCQYKAPDMDTLQIHVMDCIK
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgggagaggccacaccaggaggcgtaaccaatcagtgctctctgcccgcggcgttgcta
tggcgctgccatgacacttaccgaagcggaagtgcagtttggcgtggtgacgtaacgcat
ttccggcggaagcgggaagtggcggcgccgccgggatccctaaattccccgaattcggct
caaaaatccccgaattcggcctcaaaccgtctccgactcgcccgggccccccgggagccg
ccgatgagcggcgggcgctggcggaggcccgcggagatggtgcagccggggcccgaagcg
gatccggcgctggcggaggcgctgcagcggctgcgggcggagaaccgcgagctaaggggt
gctctgtgtcactgcaccgagtcgctccggcagcgcctggaggagctgcggaagctgcag
ctgcagcgccggggggagcgggagctgctgcggggacgttggggacaggcccgggacctg
gtgctgcacttgcggggacagcgcagggacagcaccggggacacccccagggacaccccc
ggggacaccagggacacccctggggacaccaaggacacccctggggacaccaaggacacc
cctggggatgtctgggatgccaaggacacgtctggggacatcagggacaccctcagggac
actcgggacatctccagggacacccctgacaccagcaccaagccccccgaggccaccccc
tgctccgtgtctctcccccttgaggacatccctgctgtcccagagcccccccaggccccc
tccagcacccccctggagcccagttctgaggagcagctgaagcagcgcctggcagaggct
gaggctgagctggtgacactgcgggcacgtgtggccgtggccgagctccgggctcaggac
gtttcccgcgcagctgagctgcagctgcagggcctgcgccgccagcttgagcaggacaag
gctcaggtgcaggcccaggtgacgtcgctgctgggggagctccgggagagccaaaatcgc
ctggagcggagccgggcagagcgggagcacctggagcgcagggcccggagtgatgccgag
cggtgccagcagctggaagaggtgacccagggccaccaggtgcagctagaccagcttcgg
ctccaggtgaccaacctggaaactgccctgagggtggagcggcgtggggccaccgaggag
aagaggaagctggtgcagctgcaggccgcgtaccatcacctgttccaggagtacgacgcc
cacatcaaggccagcctggagggggacaaacggagccaggtgacgcaggagcagctccgg
gcggccgaggccgcactggccctcaagcaggacctgatcgatcacctcaaggccgaggcc
gagcgccagcgggcggccttggagaccatcccggtgctgcaggcccaggccgacatctac
agggcggattttgaggcggagcgcgcggcgcgggagcagctgcacgggcagagggaggcg
ctgcaggaggagctgaaccagctgcggctgcgcctcggcggggatggggcccgggctcgt
ctggaggagatgcggaaccggcactcggagccgcccccggcaccggtcccaggaaggggt
tttggggggctcctgccccccgctgaggaagggcccgacctgtgctgccccaagtgccag
tacaaggctccggacatggacacgctgcagatccatgtcatggattgcatcaagtga

DBGET integrated database retrieval system