KEGG   Pongo abelii (Sumatran orangutan): 100174087
Entry
100174087         CDS       T01416                                 

Gene name
RAPGEF3
Definition
(RefSeq) rap guanine nucleotide exchange factor 3
  KO
K08014  Rap guanine nucleotide exchange factor 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04670  Leukocyte transendothelial migration
pon04720  Long-term potentiation
pon04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100174087 (RAPGEF3)
   04072 Phospholipase D signaling pathway
    100174087 (RAPGEF3)
   04024 cAMP signaling pathway
    100174087 (RAPGEF3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100174087 (RAPGEF3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100174087 (RAPGEF3)
  09156 Nervous system
   04726 Serotonergic synapse
    100174087 (RAPGEF3)
   04720 Long-term potentiation
    100174087 (RAPGEF3)
SSDB
Motif
Pfam: DEP
Other DBs
NCBI-GeneID: 100174087
NCBI-ProteinID: NP_001127058
UniProt: Q5NVT0
LinkDB
Position
12
AA seq 284 aa
MAQKEEITQPLWETVGWPGEGCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRM
HRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHL
LATCPNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHV
KHDWAFQDRDAQFYRFPGPEPEPVGAHEMEEELAEAVALLSQRGPDALLTVALRKPPGQR
TDEELDLIFEELLHIKAVAHLSNSVKRELAAVLLFEPHSKAGTV
NT seq 855 nt   +upstreamnt  +downstreamnt
atggcgcagaaggaagaaataacgcagccgctttgggaaactgtgggctggccaggtgag
ggctgctggcaggtgggcctggctgtggaggatagcccagctctgggagcgccgcgggtg
ggagccctccctgacgtggtgccggaggggacactactcaacatggtgttgagaaggatg
caccggccccgaagctgctcctaccagctgctgctggagcaccagcgtccgagctgcatc
caggggctgcgatggacaccactcaccaacagtgaggagtccctggatttcagcgagagc
ctggagcaggcctccacagagcgggtgctcagggctgggaggcagctgcatcggcatctg
ctggccacctgcccaaacctcatccgagaccggaagtaccaccttaggctctatcggcag
tgctgctctggccgggagctggtggatgggatcttggccctgggacttggggtccattcc
cggagccaagttgtgggaatctgccaggtgctgctggatgaaggtgccctctgccatgtg
aaacacgactgggccttccaggaccgagatgcccaattctaccgattccctgggcccgag
cccgagcccgtgggagctcatgagatggaggaggagttggccgaagctgtagccctgctc
tcccagcgggggcctgacgccctgctcactgtggcacttcgaaagcccccaggtcagcgc
acggatgaagagctggacctcatctttgaggagttgctgcacatcaaggctgtggcccac
ctctccaactcggtgaagcgagaattagcggctgttctgctctttgaaccacacagcaag
gcggggaccgtgtag

KEGG   Pongo abelii (Sumatran orangutan): 100189911
Entry
100189911         CDS       T01416                                 

Gene name
RAPGEF4
Definition
(RefSeq) rap guanine nucleotide exchange factor 4
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04670  Leukocyte transendothelial migration
pon04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100189911 (RAPGEF4)
   04072 Phospholipase D signaling pathway
    100189911 (RAPGEF4)
   04024 cAMP signaling pathway
    100189911 (RAPGEF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100189911 (RAPGEF4)
  09152 Endocrine system
   04911 Insulin secretion
    100189911 (RAPGEF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100189911 (RAPGEF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100189911 (RAPGEF4)
Membrane trafficking [BR:pon04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    100189911 (RAPGEF4)
SSDB
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N
Other DBs
NCBI-GeneID: 100189911
NCBI-ProteinID: NP_001128948
Ensembl: ENSPPYG00000012938
UniProt: Q5R8C3
LinkDB
Position
2B
AA seq 931 aa
MVATHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENV
PSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQTPCVHSRTQA
VGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDENEDAPLPTEEEKKECDEELQDTMLL
LSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHA
KGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVL
REDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKY
TVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLCPALVAHYHAQP
SQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMAFLEEFYVSVSDDARMIAA
LKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCMD
HTYTTIRVPVAASVKEVISAVADKLGSGEGLIVVKMSSGGEKVVLKPNDVSVFTTLTING
RLFACPREQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQMTIYDWELFNCVHELELIY
HTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKRVQLLKKFIKIAAHCKEYK
NLNSFFAIAMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEP
PVIPFMPLLIKAHDCKYGQNSEILQEPTLQS
NT seq 2796 nt   +upstreamnt  +downstreamnt
atggtcgctacgcacgctgcccattcttcctcctccgccgagtggatcgcctgcctggat
aaaagaccattggagcgatccagcgaagatgtggatataatcttcactcgactgaaagaa
gttaaagcttttgagaaatttcacccaaatctccttcatcagatttgcttatgtggttat
tatgagaatctggaaaagggaataacattatttcgccagggtgatattggaacaaactgg
tatgctgtcctggcagggtctttggatgttaaagtatctgagaccagcagtcaccaggat
gctgtgaccatctgtaccctgggaattgggacggcctttggagagtccattctggacaac
acaccccgccatgcaaccatcgttaccagggagagcagtgaactgctccgcatcgagcag
aaggacttcaaggcactatgggagaaatatcgacagtatatggcaggacttctggctcct
ccttatggtgttatggaaacgggctctaacaatgacaggattcctgacaaggagaacgtc
ccttcagagaagatcctcagagctggaaaaattttacgaaatgccattctctctcgagcg
cctcacatgataagagatagaaaataccacctaaagacatacagacaatgctgtgtggga
actgagcttgtagactggatgatgcagcagacaccatgtgttcactcccggactcaagct
gttggcatgtggcaagtcctgttagaagacggtgttctcaaccacgtggaccaggagcac
catttccaagacaaatatttattctatcgatttctggatgatgagaacgaggatgcccct
ttgcctactgaggaggagaagaaggagtgtgatgaggagctccaggacaccatgctgctg
ctgtcacagatgggccccgatgcccacatgaggatgatcctccgcaaaccacctggccag
aggactgtggatgacctagagattatctatgaggagcttcttcatattaaagccttatcc
catctttctaccacagtgaaacgagagttagcgggtgttctcatttttgagtctcatgcc
aaaggagggactgtgttgtttaaccagggggaagaaggtacctcctggtacattattcta
aaaggatcagtgaatgtagtcatttatggaaagggtgtggtctgcaccctgcatgaagga
gatgacttcggcaagttagcactagtgaatgatgccccacgagctgcctctatcgtctta
cgagaagataactgccatttcttaagagtagacaaggaggatttcaaccggatcctgagg
gacgtggaggcgaatacagtcagacttaaagaacatgaccaagatgtcttggtgctggag
aaggtcccagcagggaacagagcttctaatcaaggaaactcacagcctcagcaaaagtat
actgtgatgtcaggaacacctgaaaaaattttagagcattttctagaaacaatacgcctt
gaggcaactttaaatgaagcaacagattctgttttaaatgactttattatgatgcactgt
gtttttatgccaaatacccagctttgcccagcactggtggcccactaccacgcacagcct
tcacaaggtacagaacaggagaaaatggattatgccctcaacaataagaggcgagtcatc
cgcctggttctacagtgggctgccatgtatggagacctcctacaagaggatgatgtgtct
atggccttcctggaggagttttatgtatctgtatcagatgatgcccggatgattgctgcc
ctcaaggagcaactgccagagttggagaagattgtcaagcaaatctcagaagatgcaaag
gcaccacaaaagaagcacaaggttcttttgcaacagttcaatacaggtgatgagagagcc
cagaagcgccagcctatccgcggctctgatgaagttctgtttaaggtctattgcatggac
cacacctacacaaccattcgggtgccagtggccgcctcagtgaaggaagtcatcagtgca
gttgccgacaagctgggctccggggagggcctgatcgtagtcaagatgagttccggagga
gaaaaggtggtgctcaaacctaatgatgtttcggtatttacgacgctcaccattaatgga
cgcctgtttgcttgcccgcgagagcaattcgattcactgactcccttaccagaacaggaa
ggcccaactgttggaacagtgggaacttttgaactgatgagctccaaagatttagcatac
cagatgacaatttatgattgggaactcttcaactgcgtgcatgagctggagctaatctat
cacacatttggaaggcataattttaaaaagaccacagcaaacttggatttgttcctgagg
agatttaatgaaattcagttttgggtcgtcactgagatctgcctttgttctcagctcagc
aagcgtgttcagctattaaaaaaatttattaagatagcagcccactgtaaggagtataaa
aatctgaattccttttttgccatcgccatgggactaagtaacgttgctgtgagccgcttg
gcactcacgtgggagaaactgccaagcaagttcaagaagttctatgcggagtttgaaagt
ttaatggacccttcaaggaaccacagggcctacaggctgacagtagctaagctggaacct
cctgtcatccccttcatgcctttgctcattaaagcgcatgattgcaaatacggccagaac
agtgagatactacaggagccaacccttcaatcctga

DBGET integrated database retrieval system