KEGG   Pongo abelii (Sumatran orangutan): 100294567
Entry
100294567         CDS       T01416                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor precursor
  KO
K05081  prolactin receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100294567 (PRLR)
   04151 PI3K-Akt signaling pathway
    100294567 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100294567 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100294567 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100294567 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100294567 (PRLR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100294567 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind GHBP
Other DBs
NCBI-GeneID: 100294567
NCBI-ProteinID: NP_001153263
Ensembl: ENSPPYG00000015393
UniProt: Q5RAW0
LinkDB
Position
5
AA seq 622 aa
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWKPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQTNPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLDEAGKDALKSSQTIKSGEEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGQPKKPGTP
ENNKEQAKVSGVMDNNILVLVSDPHAKNMACFEESAKEGPPSLEQNQAEKALANFPATPS
KCRLQLGGLDYLDPACFTHSFH
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaaggaaaatgtggcatctgcaactgttttcactctgctactttttctcaacacctgc
cttctgaatggacagttacctcccggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaagcctgggacagatggaggacttcctaccaattat
tcgctgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataacc
ggtggccccaactcctgccactttggcaagcagtacacctccatgtggaggacatacatc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgagctttatgtggac
gtgacttacatagttcaaccagaccctcctttggagctggctgtggaagtaaaacagcca
gaagacagaaaaccctacctgtggattaaatggtctccacctaccctaattgacttaaaa
actggttggttcacgctcctgtatgaaattcgattaaagcctgagaaagcagctgagtgg
gagatccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagaccatggatactggagtgcatggagtcca
gcgaccttcattcagatacctagtgacttcaccatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtggatgatagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgtgacagtccttcccttttg
tctgaaaagtgtgaggaaccccagaccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaatcccctattttcatgccggtggatccaaatgttcaacatggcccttaccacag
cccagccagcacaaccccagatcctcttaccacaatattactgatgtgtgtgagctggct
gtgggccctgcaggtgcaccggccaccctgttggacgaagcaggtaaagatgctttaaaa
tcatctcaaaccattaagtctggagaggagggaaaggcaacccagcagagggaggtagaa
agcttccattctgagactgaccaagatacgccctggctgctgccccaggagaaaaccccc
tttggctccgctaaacccttggattatgtggagattcacaaggtcaacaaagatggcgca
ttatcattgctaccaaaacagagagagaacagcggccagcccaagaagcccgggactcct
gagaacaataaggagcaagccaaggtgtctggggtcatggataacaacatcctggtgttg
gtgtcagatccacatgctaaaaacatggcttgctttgaagaatcagccaaagagggccca
ccatcacttgaacagaatcaagctgagaaagccctggccaacttccctgcgacaccaagc
aagtgcaggctccagctgggtggtttggattacctggatcccgcatgttttacacactcc
tttcattga

KEGG   Pongo abelii (Sumatran orangutan): 100433338
Entry
100433338         CDS       T01416                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100433338 (CSF3R)
   04151 PI3K-Akt signaling pathway
    100433338 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100433338 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100433338 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433338 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100433338 (CSF3R)
   04090 CD molecules [BR:pon04090]
    100433338 (CSF3R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100433338 (CSF3R)
CD molecules [BR:pon04090]
 Proteins
  100433338 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind fn3_2 IL6Ra-bind ObR_Ig
Other DBs
NCBI-GeneID: 100433338
NCBI-ProteinID: XP_024093579
LinkDB
Position
1
AA seq 836 aa
MARLGTCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESIITLPHLNYTQAFLSCCLNWGNSLQILDQVELRAG
YPPAVPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPK
DGQSHCSIPRRHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQHGEASWALVGPLPLEALRYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVP
LEEDSGQIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPSPWPQGYVIEWGLGPPSASNSNKTWRME
QNGSATGFLLKENIRPFQLYEITVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK
TWVQLEWVPEPPELGKSPLTHYTIFWTNVQNQSFSAILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNSTVLTLMTLTPEGSELHILLGLFGLLLLLTCLCGTAWLCCSPNRKNPLWP
SVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDKKKPVPWESHNSSETCGL
PTLVQTYVLQGDPRAASTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLDFPLLQGIRVHGMEGLGSF
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggcaaggctgggaacctgcagcctgacttgggctgccctgatcatcctgctgctcccc
ggaagtctggaggagtgcgggcacatcagtgtctcagcccccatcgtccacctgggggat
cccatcacagcctcctgcatcatcaagcagaactgcagccatctggacccggagccacag
attctgtggagactgggagcagagcttcagcccgggggcaggcagcagcgtctgtctgat
gggacccaggaatctatcatcaccctgccccacctcaactacactcaggcctttctctcc
tgctgcctgaactggggcaacagcctgcagatcctggaccaggttgagctgcgcgcaggc
taccctccagccgtaccccacaacctctcctgcctcatgaacctcacaaccagcagcctt
atctgccagtgggagccaggacctgagacccacctacccaccagcttcactctgaagagc
ttcaagagccggggcaactgtcagacccaaggggactccatcctggactgcgtgcccaag
gacgggcagagccactgctccattccacgcagacacctgctgttgtaccagaatatgggc
atctgggtgcaggcggagaacgcgctggggaccagcatgtccccacaactgtgtcttgat
cccatggacgttgtgaaactggagccccccatgctgcgcaccatggaccccagccctgaa
gcggcccctccccaggcaggctgcctacagctgtgctgggagccatggcagccaggcctg
cacataaatcagaagtgtgagctgcgccacaagccgcagcatggagaagctagctgggca
ctggtgggccccctgcccttggaggcccttcgatatgagctctgcgggctcctcccagcc
acggcctacaccctgcagatacgctgcatccgctggcccctgcctggccactggagcgac
tggagccccagcctggagctgagaactaccgaacgggcccccactgtgagactggacaca
tggtggcggcagaggcagctggaccccaggacagtgcagctgttctggaagccagtgccc
ctggaggaagacagcggacagatccaaggttatgtggtttcttggagaccctcaggccag
gctggggccatcctgcccctctgcaacaccacagagctcagctgcaccttccacctgcct
tcagaagcccaggaggtggcccttgtggcctataactcagccgggacctctcgtcccacc
ccggtggtcttctcagaaagcagaggcccagccctgaccagactccatgccatggcccga
gaccctcacagcctctgggtaggctgggagccccccagtccatggcctcagggctatgtg
attgagtggggcctgggcccccccagcgcgagcaatagcaacaagacctggaggatggaa
cagaatgggagcgccacggggtttctgctgaaggagaacatcaggccctttcagctctat
gagatcactgtgactcctttgtaccaggacaccatgggaccctcccagcatgtctatgcc
tactcccaagaaatggctccctcccatgccccagagctgcatctaaagcacattggcaag
acctgggtacagctggagtgggtgcctgagccccctgagctggggaagagcccccttacc
cactacaccatcttctggaccaacgttcagaaccagtccttctccgccatcctgaatgcc
tcctcccgtggctttgtcctccatggcctggagcccgccagtctgtatcacatccacctc
atggctgccagccaggccggggccaccaacagtacagtcctcaccctgatgaccttgact
ccagaggggtcggagctacacatcctcctgggcctgttcggcctcctgctcttgctcacc
tgcctctgtggaactgcctggctctgctgcagccccaacaggaagaatcccctctggcca
agtgtcccagacccagctcacagcagcctggggtcctgggtgcccacaatcatggaggag
gatgccttccagctgcccggccttggcacgccacccatcaccaagctcacagtgctggag
gaggacaagaagaagccggtgccctgggaatcccataacagctcagagacctgtggcctc
cccactctggtccaaacctatgtgctccagggggacccaagagcagcttccacccagccc
caatcccagtctggcaccagcgatcaggtcctttatgggcagctgctgggcagccccaca
agcccagggccagggcactatctccgctgtgactccactcagcccctcttggcgggcctc
acccccagccccaagtcctatgagaacctctggttccaggccagccccctggggaccctg
gtaaccccagccccaagccaggaggacgactgtgtctttgggccactgctcgacttcccc
ctcctgcaggggatccgggtgcatgggatggaggggctggggagcttctag

KEGG   Pongo abelii (Sumatran orangutan): 100440118
Entry
100440118         CDS       T01416                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha isoform X1
  KO
K05068  interleukin 2 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440118 (IL2RA)
   04151 PI3K-Akt signaling pathway
    100440118 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100440118 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100440118 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100440118 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100440118 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    100440118 (IL2RA)
   04659 Th17 cell differentiation
    100440118 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440118 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100440118 (IL2RA)
   05162 Measles
    100440118 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100440118 (IL2RA)
   04090 CD molecules [BR:pon04090]
    100440118 (IL2RA)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100440118 (IL2RA)
CD molecules [BR:pon04090]
 Proteins
  100440118 (IL2RA)
SSDB
Motif
Pfam: Sushi TMEM100 Stevor
Other DBs
NCBI-GeneID: 100440118
NCBI-ProteinID: XP_002820543
Ensembl: ENSPPYG00000002066
UniProt: A0A663DFI2 H2N9P4
LinkDB
Position
10
AA seq 272 aa
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEVAHATFKAVVYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSAARNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTSETETSQFPGEEKPQASPEGHPESETSCLVTTADFQIQTEMASTMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRRRKSRRTI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggattcatacctgctgatgtggggactgctcacgttcatcatggtgcctggctgccag
gcagagctctgtgacgatgacccaccagaggtcgcacatgccaccttcaaagctgtggtc
tacaaggaaggaaccatgttgaactgtgagtgcaagagaggtttccgcagaataaaaagc
gggtcactctatatgctctgtacaggaaactctagccactcatcctgggacaaccaatgt
caatgcacaagctctgccgctcggaacacaacaaaacaagtgacacctcaacctgaagaa
cagaaagaaagaaaaaccacagaaatgcaaagtccaatgcagccggtggaccaagcgagc
cttccaggtcactgcagggaacctccaccgtgggaaaatgaagccacagagagaatttat
cattttgtggtggggcagatggtttactaccagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcgtctgcaaaatgacccatgggaagacaaggtggacccagccc
cagctcatatgcacaagtgaaacggagaccagtcagtttccaggtgaagagaagcctcag
gcaagccccgaaggccatcctgagagtgagacttcctgcctcgtcacaacagcagatttt
caaatacagacagaaatggcttcaaccatggagacgttcatatttacaacagagtaccag
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctcctgagtgggcttacc
tggcagcggagacggaggaagagtagaagaactatctag

KEGG   Pongo abelii (Sumatran orangutan): 100440306
Entry
100440306         CDS       T01416                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta
  KO
K05057  oncostatin M receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440306 (OSMR)
   04151 PI3K-Akt signaling pathway
    100440306 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100440306 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100440306 (OSMR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100440306 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100440306
NCBI-ProteinID: XP_024102699
Ensembl: ENSPPYG00000015413
LinkDB
Position
5
AA seq 980 aa
MALFAVFPTTFFLTLLSLRTYQSEVSAERLPLTPVSLKVSTNSTHQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSVVDD
AKFPEPNFWSNWSSWEEVSVQDSFGQDILFVFPKDKLVEEGSNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTSFNLSSVPFIRNKGTNIYCEASQGNVSKGIKGIVLFVSKVLEEP
KNFSCETQDFKTLHCTWDPGTDTALGWFKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSEETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSMRN
NFTYLCQIELHGEGKMMQQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWS
GQNFTTLEAAPSEAPDVWRIVNLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPS
RSELHSIPAPANSTKLILDRCSYQICVTANNSVGASPASVIVISADPESKDVEEERIAGT
EGGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDF
RIYGLSTKRIACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQG
YHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFVTPFTS
AGEGPNATFTKVTTPDEHSAMLIHILLPMVFCVLLIMVMCYLKSQWIKETCYPDIPDPYK
SSILSLIKFKENPHLTIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLY
LLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVPPKAPSMLGLMTSPENVLKALEK
NYMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEPPHCSEYKMQMAVPLRLALPP
PTENSSLSSITLLDPGEHYR
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggctctatttgcagtctttccgacaacattcttcttaacattgctgtccttgaggact
taccagagtgaagtctcggctgaacgtttaccattgactcctgtatcacttaaagtttcc
accaattctacacatcagagtttgcatttacaatggactgtccacaaccttccttatcat
caggaattgaaaatggtgtttcagatccagatcagtaggattgaaacatccaatgtcatc
tgggtggggaattacagcaccactgtgaagtggaaccaggttctgcattggagctgggaa
tccgagctccctttggaatgtgccacacactttgtaagaataaagagtgtggtggacgat
gccaagttccctgagccaaatttctggagcaactggagttcctgggaggaagtcagtgta
caagattcttttggacaggatatattgttcgttttccctaaagataagctggtggaagaa
ggctccaatgttaccatttgttacgtttctaggaacattcaaaataatgtatcctgttat
ttggaagggaaacagattcatggagaacaacttgatccacatgtaacttcattcaacttg
agtagtgtgcctttcattaggaataaagggacaaatatctattgtgaggcaagtcaagga
aatgtcagtaaaggcataaaaggcatcgttctttttgtctcaaaagtacttgaggagccc
aagaacttttcttgtgaaacccaggacttcaagactttgcactgtacttgggatcctggg
acagacactgccttggggtggtttaaacaaccttcccaaagctacactttatttgaatca
ttttctggggaaaagaaactttgtacacacaaaaactggtgtaattggcaaataactcaa
gactcagaagaaacttataacttcacactcatagctgaaaattacttaaggaagagaagt
gtcaatatcctttttaacctgactcatcgagtttatttaatgaatccttttagtgtcaac
tttgaaaatgtaaatgccacaaatgccatcatgacctggaaggtgcattccatgaggaat
aatttcacatatttgtgtcagattgaactccatggtgaaggaaaaatgatgcaacagtac
aatgtttccatcaaggtgaacggtgagtacttcttaagtgaactggaacctgccacagag
tacatggcgcgagtacgctgtgctgatgccagccacttctggaaatggagtgaatggagt
ggtcaaaacttcaccacacttgaagctgctccctcagaggcccctgatgtctggagaatt
gtgaacttggagccaggaaatcatactgtgaccttattctggaagccattatcaaaactg
catgccaatggaaagatcctgttctataatgtagttgtagaaaacctagacaaaccatcc
aggtcagagctccattccattccggcaccggccaacagcacaaaactaatcctcgacagg
tgttcctaccaaatctgtgtcacagccaacaacagtgtgggtgcttctcctgcttctgta
atagtcatctctgcagaccctgaaagcaaagatgttgaggaagaaagaattgcaggcaca
gagggtggattctctctgtcttggaaaccccaacctggagatgttataggctatgttgtg
gactggtgtgaccatacccaggatgtgctcggtgatttccagtggaagaatgtaggtccc
aatactacaagcacagtcattagcacagatgcttttaggccaggagttcgatacgacttc
agaatttatgggttatctacaaaaaggattgcttgtttattagagaaaaaaacaggatac
tctcaggaacttgctccttcagacaaccctcacgtgctggtggatacgttgacatcccac
tccttcactctgagttggaaagattactctactgaatctcaacctggttttatacaaggg
taccatgtctatctgaaatccaaggcgaggcagtgccacccacgatttgaaaaggcagtt
ctttcagatggttcagaatgttgcaaatacaaaattgacaacccggaagaaaaggcattg
attgtggacaacctaaagccggaatccttctatgagtttttcgtcacaccattcactagt
gctggtgaaggccccaatgctacgttcacgaaggtcacgactccggatgaacactccgcg
atgctgattcatatcctactgcccatggttttctgcgtcttgctcatcatggtcatgtgc
tacttgaaaagtcagtggatcaaggagacctgttatcctgacatccctgacccttacaag
agcagcatcctgtcattaataaaattcaaggagaaccctcacctaacaataatgaatgtc
agtgactgtatcccagatgctattgaagttgtaagcaagccagaagggacaaagatacag
ttcctaggcactaggaagtcactcacagaaactgagttgactaagcccaactacctttat
ctccttccaacagaaaagaatcactctggccctggcccctgcatctgttttgagaacttg
acctataaccaggcagcttctgactctggctcttgtggccatgttccagtacccccaaaa
gccccaagtatgctgggactaatgacctcacctgaaaatgtactaaaggcactagaaaaa
aactacatgaactccctgggagaaatcccagctggagaaacaagtttgaattatgtgtcc
cagttggcttcacccatgtttggagacaaggacagtctcccaacaaacccagtagaacca
ccacactgttcagagtataaaatgcaaatggcagtccccctgcgtcttgccttgcctccc
ccgaccgagaatagcagcctctcctcaattacccttttagatccaggtgaacactaccgc
taa

KEGG   Pongo abelii (Sumatran orangutan): 100441293
Entry
100441293         CDS       T01416                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X1
  KO
K05131  interferon receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05160  Hepatitis C
pon05162  Measles
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100441293 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    100441293 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100441293 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100441293 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100441293 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    100441293 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    100441293 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100441293 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441293 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100441293 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    100441293 (IFNAR2)
   05164 Influenza A
    100441293 (IFNAR2)
   05162 Measles
    100441293 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    100441293 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100441293 (IFNAR2)
   05169 Epstein-Barr virus infection
    100441293 (IFNAR2)
   05165 Human papillomavirus infection
    100441293 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100441293 (IFNAR2)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IFN receptor family
   100441293 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100441293
NCBI-ProteinID: XP_024095142
LinkDB
Position
21
AA seq 590 aa
MRLVCPSCLPGPHLRPQDPSRPLPGALHASPLLGVRFCCTPPRPTPPHQGCPGHRALATA
RYVKVKRRLKIAKMLLSQNAFIVRSLNLFLMVYISLVFGISHDSPDYTDESCTFKISLRN
FRSILSWELKNHSIVPTHYMLLYTIMSKPEDLKMVMNCANTTRSFCDLTDEWRSTHEAYV
TILEGFSGNTTLFSCSHNFWLAIDMSFEPPEFETVGFTNHINVMVKFPSIVEEELQFDLS
LVIEEQSEGIVKKHKPEIRGNMSGNFTYVIDKLIPNTNYCVSVYFEHSDEQAVIKSPLKC
TLLPPGQESESAESAKIGGIITVFLIALVLTSAIVTLKWIGYICLRNSLPKVLNFHNFLA
WPFLNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAAPRTSGGGYTMHGLTVRP
LGQASATSTESQFIDPESEEEPDLPEVDVELPMTPKGSPQRLELLSGPCERRESPLQDPF
LEEDYSSTEGSRGRITFNVDLNSVFLRVLDDEDSDDLEEAPLMISSHPEEMVDPEGPDNV
QSSHLLASGEGTQPTFPSPSSEDLWSEDAPSDQSDTSESDVDLGDGYIMR
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgcggctagtgtgcccttcctgtctcccggggccgcacctgcgaccccaggacccctcc
cggcccctgcccggcgccctccacgcgtcgcccctgctgggagtccgcttttgttgcacc
cctccgcgtcccaccccaccccaccaaggatgcccaggacaccgggcacttgccactgca
agatatgtaaaagtcaagagaagactaaaaatagcaaagatgcttttgagccagaatgcc
ttcatcgtcagatcacttaatttgtttctcatggtgtatatcagcctcgtgtttggtatt
tcacatgattcgcctgattacacagatgaatcttgcactttcaagatatcattgcgaaat
ttccggtccatcttatcatgggaattaaaaaaccactccattgtaccaactcactatatg
ttgctgtatacaatcatgagtaaaccagaagatttgaagatggttatgaactgtgcaaat
accacaagatcattttgtgacctcacagatgagtggagaagcacacacgaggcctatgtc
accatcctagaaggattcagcgggaacacaaccttgttcagttgctcacacaatttctgg
ctggccatagacatgtcttttgaaccaccagagtttgagactgttggttttaccaaccac
attaatgtgatggtgaaatttccatctattgttgaggaagaattacagtttgatttatca
ctcgtcattgaagaacagtcagaggggattgttaagaagcataaacccgaaataagagga
aacatgagtggaaatttcacctatgtcattgacaagttaattccaaacacgaactactgt
gtatctgtttattttgagcacagtgatgagcaggcagtaataaagtctcccttaaaatgc
acccttcttccacctggccaggaatcagaatcagcagaatctgccaaaataggaggaata
attactgtgtttttgatagcgttggtcttgacaagtgccatagtgacactgaaatggatt
ggttatatatgcttaagaaacagcctccccaaagtcttgaattttcataactttttagcc
tggccatttcttaacctgccaccgttggaagccatggatatggtggaggtcatttacatc
aacagaaagaagaaagtgtgggattataattatgatgatgagagtgacagcgatactgag
gcagcagcgcccaggacaagtggcggtggctataccatgcatggactgactgtcaggcct
ctgggtcaggcctctgccacctctacagaatcccagtttatagatccagagtccgaggag
gagcctgacctgcctgaggttgacgtggagctccccatgacgccaaagggcagccctcag
cgcttggaactcttgagtgggccctgtgagaggagagagagtccactccaggaccctttt
ctggaagaggactacagctccactgaggggtctaggggcagaattaccttcaatgtggat
ttaaactctgtgtttttgagggttcttgatgatgaggacagtgacgacttagaagaagcc
cctctgatgatatcgtctcatccagaagagatggttgacccagagggtcctgacaatgtg
caatcaagccatttgctggccagcggggaagggacacagccaacctttcccagcccctct
tcagaggacctgtggtctgaagatgctccatctgatcagagtgacacttctgagtcagat
gttgaccttggggatggttatataatgagatga

KEGG   Pongo abelii (Sumatran orangutan): 100443118
Entry
100443118         CDS       T01416                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100443118 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    100443118 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100443118 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100443118 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100443118 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    100443118 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    100443118 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100443118 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100443118 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100443118 (IFNAR1)
   05160 Hepatitis C
    100443118 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    100443118 (IFNAR1)
   05164 Influenza A
    100443118 (IFNAR1)
   05162 Measles
    100443118 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    100443118 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100443118 (IFNAR1)
   05169 Epstein-Barr virus infection
    100443118 (IFNAR1)
   05165 Human papillomavirus infection
    100443118 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100443118 (IFNAR1)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IFN receptor family
   100443118 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 100443118
NCBI-ProteinID: XP_024095202
Ensembl: ENSPPYG00000011374
LinkDB
Position
21
AA seq 558 aa
MMVALLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKPGMDNWIKLPGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHVEAEDKAIVIHISPPGTKDSVMWALDGLSFTYSLVIWKNSSGVEER
IENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSV
QNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQ
KGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFHIRSLSDSFHIYIGAPKQSGNK
PVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSS
VFSDVVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSNID
EYFSEQSLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYGSQTSQDSGNYS
NEDESESKTSEELQQDFV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgatggtcgccctcctgggcgcgacgaccctagtgctcgtcgccgtggcgccatgggtg
ttgtccgcagccgcaggtggaaaaaatctaaaatctcctcaaaaagtagaggtcgacatc
atagatgacaactttatcctgaggtggaacaggagcgatgagtctgtcgggaatgtgact
ttttcattcgattatcaaaaacctgggatggataattggataaaattgcctgggtgtcag
aatattactagtaccaaatgcaacttttcttcactcaagctgaatgtttatgaagaaatt
aaattgcgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgactcattt
acaccatttcgcaaagctcaaattggtcctccagaagtacatgtagaagctgaagataag
gcaatagtgatacacatctctcctcctggaacaaaagatagtgttatgtgggctttggat
ggtttaagctttacatatagcttagttatttggaaaaactcttcaggtgtagaagaaagg
attgaaaatatttattccagacataaaatttataaactctcaccagagactacttattgt
ttaaaagttaaagcagcactacttacgtcatggaaaattggtgtctatagtccagtacat
tgtataaagaccacagttgaaaatgaactacctccaccagaaaacatagaagtcagtgtt
caaaatcagaactatgttcttaaatgggattatacatatgcaaacatgacgtttcaagtt
cagtggctccacgcctttttaaaaaggaatcctggaaaccatttgtataaatggaaacaa
atacctgactgtgaaaatgtcaaaactacccagtgtgtctttcctcaaaacgttttccaa
aaaggaatttaccttctccgcgtacaagcatctgatggaaataacacatctttttggtct
gaagagataaagtttgatactgaaatacaagctttcctacttcctccagtctttcacatt
agatcccttagtgattcattccatatctatattggtgctccaaaacagtctggaaacaag
cctgtgatccaggattatccactgatttatgaaattattttttgggaaaacacttcaaat
gctgagagaaaaattatcgagaaaaaaactgatgttactgttcctaatttgaaaccactg
actgtatattgtgtgaaagccagagcacacaccatggatgaaaagctgaataaaagcagt
gtttttagtgacgttgtgtgtgagaaaacaaaaccaggaaatacctctaaaatttggctt
atagttggaatttgtattgcattatttgctctcccgtttgtcatttatgctgcgaaagtc
ttcttgagatgcattaattatgtcttctttccatcacttaaaccttcttccaatatagat
gagtatttctctgaacagtcattgaagaatcttctgctttcaacttctgaggaacaaatc
gaaaaatgttttataattgaaaatataagcacaattgctacagtagaagaaactaatcaa
actgatgaagatcataaaaaatacggttcccaaactagccaagattcaggaaattattct
aatgaagatgaaagtgaaagtaaaacaagtgaagaactacagcaggacttcgtatga

KEGG   Pongo abelii (Sumatran orangutan): 100449812
Entry
100449812         CDS       T01416                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha
  KO
K05071  interleukin 4 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100449812 (IL4R)
   04151 PI3K-Akt signaling pathway
    100449812 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100449812 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100449812 (IL4R)
   04658 Th1 and Th2 cell differentiation
    100449812 (IL4R)
   04659 Th17 cell differentiation
    100449812 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449812 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100449812 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100449812 (IL4R)
   04090 CD molecules [BR:pon04090]
    100449812 (IL4R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100449812 (IL4R)
CD molecules [BR:pon04090]
 Proteins
  100449812 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 100449812
NCBI-ProteinID: XP_024089279
Ensembl: ENSPPYG00000007213
LinkDB
Position
16
AA seq 826 aa
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYLSISTCEWKMNGPTNCSTELRL
LYQLVFLLSETHTCVPENNGGAGCVCHLLMDDMVSADNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
EPSLRIAASTLKSGISYRARVRAWARWYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSIS
CLVILAVCVLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAPVSQWEKRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGGEN
GGFCQQDMGESCLLPSSGSTSAHMPWDEFPSAGPKKAPPWGKEQPLHLEPSPPASPTQSP
DNLTCTETPLVIADNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEP
TTVPQPEPETWEQILRRNVLQHGAAAAPISAPTSGYREFVHAVEQGGTQASVVVGLGPPG
EAGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDR
EPPRSPQSSHLPSSSPEHLGLEPGEKVEDVPKPPLPQEQATDPLGDSLGSGIVYSALTCH
LCGHLKQCHGQEDDGQTPVVASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPAS
LAPSGISEKSKSSSSFHLAPGNAQSSSPTPKIVNFVSVGPTYMRVS
NT seq 2481 nt   +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctgggaacatgaaggtcctgcaggagcccacctgcgtctccgactacttgagc
atctctacttgcgagtggaagatgaatggtcccaccaattgcagcaccgagctccgcctg
ttgtaccagctggtttttctgctctccgaaacccacacgtgtgtccccgagaacaatgga
ggcgcggggtgcgtgtgccacctgctcatggatgacatggtcagtgcagacaactatacg
ctggacctgtgggctgggcagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctcacagttcacaccaatgtctccgacactctgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatcatctcacctatgca
gtcaacatttggagtgaaaacgacccggcagatttcagaatctataacgtgacctaccta
gaaccctccctccgcatcgcagccagcaccctgaagtctgggatttcctacagggcacgg
gtgagggcctgggctcggtggtataacaccacctggagtgagtggagccccagcaccaag
tggcacaactcctacagggagcccttcgagcagcacctcctgctgggcgtcagcatttcc
tgccttgtcatcctggccgtctgcgtgttgtgctatgtcagcatcaccaagattaagaaa
gaatggtgggatcagattcccaacccagcccgcagccgcctcgtggctataataatccag
gatgctccggtgtcacagtgggagaagcggtcccgaggccaggaaccagccaagtgccca
cactggaagaattgtcttaccaagctcttgccctgttttctggagcacaacatgaaacgg
gatgaggatccccacaaggctgccaaagagatgcctttccagggctctggaaaatcagca
tggtgcccggtggagatcagcaagacagtcctctggccagagagcatcagcgtggtgcga
tgcgtggagttgtttgaggccccggtggagtgtgaggaggaggaggaggaggtagaggaa
gaaaaagggagcttctgtgcatcgcctgagagcagcagggatgacttccaggagggaagg
gagggcattgtggcccggctaacagagagcttgttcctggacctgctcggaggggagaat
gggggcttttgccagcaggacatgggggagtcgtgccttcttccatcttcaggaagtacg
agtgctcacatgccctgggatgagttcccaagtgcagggcccaagaaggcacctccctgg
ggcaaggagcagcctcttcacctggagccgagtcctcctgccagcccgacccagagtcca
gacaacctgacttgcacagagacacccctcgtcatcgcagacaaccccgcttaccgcagc
ttcagcaactccctgagccagtcaccgtgtcccagagagctgggtccagacccactgctg
gccagacacctggaggaagtggaacccgagatgccctgtgtcccccagctctctgagcca
accactgtgccccaacctgagccagaaacctgggagcagatcctccgccgaaatgtcctc
cagcacggggcggctgcagcccccatctcggcccccaccagtggctatcgggagtttgta
catgcggtggagcagggtggcacccaggccagtgtggtggtgggcttgggtcccccagga
gaggctgggtacaaggccttctcaagcctgcttgccagcagtgccgtgtccccggagaaa
tgcgggtttggggctagcagtggggaagaggggtataagcctttccaagacctcattcct
ggctgccctggggaccctgccccagtccctgtccccttgttcacctttggactggacagg
gagccacctcgcagcccgcagagctcacatctcccaagcagctccccagagcacctgggt
ctggagccaggggaaaaggtagaggacgtgccgaagcccccacttccccaggagcaggcc
acagacccccttggggacagcctgggcagtggtattgtctactcagccctcacctgccac
ctgtgcggccacctgaagcagtgtcatggccaggaggatgatggccagacccctgtcgtg
gccagtccctgctgtggctgctgctgtggagacaggtcctcgccccctacaacccccctg
agggccccagacccctctccaggtggggttccactggaggccagcctgtgtccggcctcc
ctggcaccctcgggcatctcagagaagagtaaatcctcatcgtccttccatcttgcccct
ggcaatgctcagagctcaagcccgacccccaaaatcgtgaactttgtctccgtgggaccc
acatacatgagggtctcttag

KEGG   Pongo abelii (Sumatran orangutan): 100451189
Entry
100451189         CDS       T01416                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor isoform X2
  KO
K05080  growth hormone receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100451189 (GHR)
   04151 PI3K-Akt signaling pathway
    100451189 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100451189 (GHR)
   04060 Cytokine-cytokine receptor interaction
    100451189 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100451189 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100451189 (GHR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100451189 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 100451189
NCBI-ProteinID: XP_003776629
Ensembl: ENSPPYG00000015431
UniProt: A0A6D2YB15 A0A2J8WBK2
LinkDB
Position
5
AA seq 638 aa
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDAVYHGSKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPPN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLFKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEGS
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LANNDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADA
KKCIPVAPHVKVESHIQPSFNQEDIYITTESLTTAAGRPGTAEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcactggcaggatcaagtgatgctttttct
ggaagtgaggccacagcagctatccttagcagagcaccctggagtctgcaaagtgttaat
ccaggcctaaagacaaattcttctaaggagcctaaattcaccaagtgccgttcacctgag
cgagagactttttcatgccactggacagatgcagtttatcatggttcaaagaacctagga
cccatacagctattctataccagaaggaacactcaagaatggactcaagaatggaaagaa
tgccctgattatgtttctgctggggaaaacagctgttactttaattcatcatttacctcc
atctggataccttattgtatcaagctaactagcaatggtggtacagtggatgaaaagtgt
ttctctgttgacgaaatagtgcaaccagatccacccattgccctcaactggactttactg
aacgtcagtttaactgggattcatgcagatatccaagtgagatgggaagcaccacccaat
gcagatattcagaaaggatggatggttctggagtatgaacttcaatacaaagaagtaaat
gaaactaaatggaaaatgatggaccctatattgtcaacatcagttccagtgtactcattg
aaagtggataaggaatatgaagtgcgtgtgagatccaaacaacgaaactctggaaattat
ggcgagttcagtgaggtgctctatgtaacacttcctcagatgagccaatttacatgtgaa
gaagatttctactttccatggctcttaattattatctttggaatatttggactaacggtg
atgctatttgtattcttattttctaaacagcaaaggattaaaatgctgattctgccccca
gttccagttccaaagattaaaggaatcgatccagatctcttcaaggaaggaaaattagag
gaggtgaacacaatcttagccattcatgatagctataaacccgaattccacagtgatgac
tcttgggttgaatttattgagctagatattgatgagccagatgaaaagactgagggatca
gacacagacagacttctaagcagtgaccatgagaaatcacatagtaacctaggggtgaag
gatggtgactctggacgtaccagctgttgtgaacctgacattctggagactgatttcaat
gccaatgacatacatgagggtacctcagaggttgctcagccacagaggttaaaaggggaa
gcagatctgttatgccttgaccagaagaatcaaaataactcaccttatcatgatgcttgc
cctgctactcagcagcccagtgttatccaagcagagaaaaacaaaccacaaccacttcct
actgaaggagctgagtcaactcaccaagctgcccatattcagctaagcaatccaagttca
ctggcaaacaacgacttttatgcccaggtgagcgacattacaccagcaggtagtgtggtc
ctttccccgggccaaaagaataaggcagggatgtcccagtgtgacatgcacccggaaatg
gtctcactctgccaagaaaacttccttatggacaatgcctacttctgtgaggcagatgcc
aaaaagtgcatccctgtggctcctcacgtcaaggttgaatcacacatacagccaagcttt
aaccaagaggacatttacatcaccacagaaagccttaccactgctgctgggaggcctggg
acagcagaacatgttccaggttctgagatgcctgtcccagactatacctccattcatata
gtacagtccccacagggcctcatactcaatgcgactgccttgcccttgcctgacaaagag
tttctctcatcgtgtggctatgtgagcacagaccaactgaacaaaatcatgccttag

KEGG   Pongo abelii (Sumatran orangutan): 100452294
Entry
100452294         CDS       T01416                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor isoform X1
  KO
K05079  erythropoietin receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100452294 (EPOR)
   04151 PI3K-Akt signaling pathway
    100452294 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100452294 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452294 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452294 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100452294 (EPOR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100452294 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 100452294
NCBI-ProteinID: XP_002828735
UniProt: A0A2J8S0G4
LinkDB
Position
19
AA seq 508 aa
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVLILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggaccacctcggggcgtccctctggccccaggtcggctccctttgtctcctgctcgct
ggggccgcctgggcgcccccgcccaacctcccggaccccaagttcgagagcaaagcggcc
ttgctggcggcccgcgggcccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgtttctgggaggaagcggcgagcgctggggtgggcccgggcaactacagcttctcc
taccagctcgaggatgagccatggaagctgtgtcgcctgcaccaggctcccacggctcgt
ggtgcggtgcgcttctggtgttcgctgcccacagccgacacgtcgagcttcgtgccccta
gagttgcgcgtcacagcagcctccggcgctccgcgatatcaccgtgtcatccacatcaat
gaagtagtgctcctggacgcccccgtggggctggtggcgcggttggctgacgagagcggc
cacgtagtgttgcgctggctcccgccgcctgagacacccatgacgtcccacatccgctac
gaggtggacgtctcggccggcaacggcgcagggagcgtgcagagggtggagatcctggag
ggccgcaccgagtgtgtgctgagcaacctgcggggccggacgcgctacaccttcgccgtc
cgcgcgcgtatggctgagccgagcttcggcggcttctggagcgcctggtcggagcctgtg
tcgctgctgacgcctagtgacctggaccccctcatcctgacgctctccctcatcctcgtg
ctcatcctggtgctgctgaccgtgctcgcgctgctctcccaccgccgggctctgaagcag
aagatctggcctggcatcccgagcccagagagtgagtttgaaggcctcttcaccacccac
aagggtaacttccagctgtggctgtaccagaatgatggctgcctgtggtggagcccctgc
acccccttcacagaggacccacctgcttccctggaagtcctctcagagcgctgctggggg
acgatgcaggcagtggagccggggacagatgatgagggccccctgctggagccggtgggc
agtgagcatgcccaggatacctatctggtgctggacaagtggttgctgccccggaacccg
cccagtgaggacctcccagggcctggtggcagtgtggacatagtggccatggatgaaggc
tcagaagcatcctcctgctcatctgctttggcctcgaagcccagcccagagggagcctct
gctgccagctttgagtacactatcctggaccccagctcccagctcttgcgtccatggaca
ctgtgccctgagctgccccctaccccaccccacctaaagtacctgtaccttgtggtatct
gactctggcatctcaactgactacagctcaggggactcccagggagcccaagggggctta
tctgatggcccctactccaacccttatgagaacagccttatcccagctgctgagcctctg
ccccccagctatgtggcttgctcttag

KEGG   Pongo abelii (Sumatran orangutan): 100454903
Entry
100454903         CDS       T01416                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
pon05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100454903 (IL2RG)
   04151 PI3K-Akt signaling pathway
    100454903 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100454903 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100454903 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100454903 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100454903 (IL2RG)
   04659 Th17 cell differentiation
    100454903 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454903 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100454903 (IL2RG)
   05340 Primary immunodeficiency
    100454903 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100454903 (IL2RG)
   05162 Measles
    100454903 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100454903 (IL2RG)
   04090 CD molecules [BR:pon04090]
    100454903 (IL2RG)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100454903 (IL2RG)
CD molecules [BR:pon04090]
 Proteins
  100454903 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 IL4Ra_N
Other DBs
NCBI-GeneID: 100454903
NCBI-ProteinID: XP_009233240
Ensembl: ENSPPYG00000020446
UniProt: H2PVY5 A0A6D2WMT9
LinkDB
Position
X
AA seq 369 aa
MLKPSLPFRSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTSMPADSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGVLGEGPGASPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcagatccctcttattcctgcagctgcccctgctggga
gtggggctgaacacgacaattctgacgcccaatgggaatgaagacaccacagctgatttc
ttcctgacctctatgcccgctgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaactcagataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaaccta
acacttcacaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccctgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatacttcaaaagagaatcctttcctgtttgcgttg
gaagccgtggttatctccgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gtcctcggggaggggcctggggcctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctgaagcctgaaacctga

KEGG   Pongo abelii (Sumatran orangutan): 100459702
Entry
100459702         CDS       T01416                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04659  Th17 cell differentiation
pon04932  Non-alcoholic fatty liver disease
pon05163  Human cytomegalovirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100459702 (IL6R)
   04066 HIF-1 signaling pathway
    100459702 (IL6R)
   04151 PI3K-Akt signaling pathway
    100459702 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459702 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100459702 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100459702 (IL6R)
   04659 Th17 cell differentiation
    100459702 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459702 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100459702 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100459702 (IL6R)
   05163 Human cytomegalovirus infection
    100459702 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459702 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100459702 (IL6R)
   04090 CD molecules [BR:pon04090]
    100459702 (IL6R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100459702 (IL6R)
CD molecules [BR:pon04090]
 Proteins
  100459702 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 Ig_2 fn3 I-set Ig_5
Other DBs
NCBI-GeneID: 100459702
NCBI-ProteinID: XP_024090051
Ensembl: ENSPPYG00000000781
LinkDB
Position
1
AA seq 484 aa
MLAVGCALLAALLAAPGEALAPGRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHSSRWAGMGRRLLLRSVQLHDSGNYSCYQAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSWESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTGFSPQTIPGGIWDPAGESRSPPAENEVSTPMQALTTNKDDDNIL
VRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCVAIVLRFKKTWKLRALKEGKTSI
HPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDY
FFPR
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgctggccgtcggctgcgcgctgctggctgccctgctcgccgcgccgggagaggcgctg
gccccagggcgctgccctgcgcaggaggtggcgagaggtgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccaggggtagagccggaagacaatgccactgttcactgg
gtgctcaggaagccggctgcaggctcccattctagcagatgggctggcatgggaaggagg
ctgctgctgaggtcggtgcagctccatgactctggaaactattcatgctaccaggccggc
cgcccagctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaacgttgtttgtgagtggggtcctcggagcacccca
tccctgacgaccaaggctgtgctgttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcctgggagtcccagaagttctcctgccagttggcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgttgccagtagtgtcgggagc
aagttcagcaaaactcaaacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcactgccgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctacagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacatggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagttcgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacaccttggacaggcttctctcca
cagaccatcccgggtggcatttgggacccagctggagaatccaggagtcctccagctgag
aacgaggtgtccacccccatgcaggcacttactactaataaagacgatgataatattctc
gtcagagattctgcaaatgcgacaagcctcccagtgcaagattcttcttcggtaccactg
cccacattcctggttgctggagggagcctggccttcggaacgctcctctgcgttgccatt
gttctgaggttcaagaagacgtggaagctgcgggctctgaaggaaggcaagacaagcata
cacccgccgtactctttggggcagctggtcccggagaggcctcgacccaccccagtgctt
gttcctctcatctccccaccggtgtcccccagcagcctggggtctgacaatacctcgagc
cacaaccgaccagatgccagggacccacggagcccttatgacatcagcaatacagactac
ttcttccccagatag

KEGG   Pongo abelii (Sumatran orangutan): 100460977
Entry
100460977         CDS       T01416                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100460977 (IL2RB)
   04151 PI3K-Akt signaling pathway
    100460977 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100460977 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100460977 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100460977 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100460977 (IL2RB)
   04659 Th17 cell differentiation
    100460977 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460977 (IL2RB)
   05202 Transcriptional misregulation in cancer
    100460977 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100460977 (IL2RB)
   05162 Measles
    100460977 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100460977 (IL2RB)
   04090 CD molecules [BR:pon04090]
    100460977 (IL2RB)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100460977 (IL2RB)
CD molecules [BR:pon04090]
 Proteins
  100460977 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 100460977
NCBI-ProteinID: XP_024095787
LinkDB
Position
22
AA seq 576 aa
MIVSFLRPPQPCGTGFLPRLHPVDVMAASALSWRLPLLILLLPLATPWASAAVNGTSQFT
CFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDS
QKLTAVDIVTLRVMCREGVRWRMMAIQDFKPFENLRLMAPISLRVVHVETHRCNISWEIS
QASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQG
EFTTWSPWSQPLAFRTKPAGLGKDTIPWLGHLLVGLSGAFGFIILVYLLINCGNTGPWLK
KVLKCHTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKATQ
LLLKQDKVPEPTSLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYAEEDPDEG
GAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERL
RPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSR
PPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgattgtaagtttcctgaggcctccccagccatgtggaactggcttccttcctcggctc
caccctgtggatgtaatggcggcctctgctctgtcctggcgtctgcccctcctcatcctc
ctcctgcccctggctaccccttgggcatctgcagcggtgaatggcacttcccagttcaca
tgcttctacaactcgagagccaacatctcctgtgtctggagccaagatggggctctgcag
gacacttcctgccaagtccatgcctggccggacagacggcggtggaaccaaacctgtgag
ctgctccccgtgagtcaagcatcctgggcctgcaacctgatcctcggagccccagattct
cagaaactgaccgcagtggacatcgtcaccctgagggtgatgtgccgtgaaggggtgcga
tggaggatgatggctatccaggacttcaaaccctttgagaaccttcgcctgatggccccc
atctccctccgagtcgtccacgtggagacccacagatgcaacataagctgggaaatctcc
caagcctcccactactttgaaagacacctggagttcgaggcccggacgctgtccccaggc
cacacctgggaggaggcccccctgctgactctcaagcagaagcaggaatggatctgcctg
gagacactcaccccagacacccagtatgagtttcaggtacgggtcaagcctctgcaaggc
gagttcacgacctggagcccctggagccagcccctggccttcaggacaaagcctgcaggc
cttgggaaggacaccattccgtggcttggccacctcctcgtgggcctcagcggggctttt
ggcttcatcatcttagtgtacttgttgatcaattgcgggaacaccgggccgtggctgaag
aaggtcctgaagtgtcacaccccagacccctcaaagttcttttcccagctgagctcagag
catggaggagacgtccagaagtggctctcttcgcccttcccctcatcgtccttcagccct
ggtggcttggcacctgagatctcgccactagaagtgctggagagggacaaggcgacgcag
ctgctcctgaagcaggacaaggtgcctgagcccacatccttaagcagcaaccactcgctg
accagctgcttcaccaaccagggttacttcttcttccacctcccggatgccttggagata
gaggcctgccaggtgtactttacttacgacccctatgcagaggaagaccctgatgagggt
ggggccggggcacccacagggtcttccccccaacccctgcagcctctgtcaggggaggac
gacgcctactgcaccttcccctccagggatgacctgctgctcttctcccccagtctcctc
ggtggccccagccccccaagcactgcccctgggggcagcggggctggtgaagaaaggctg
cgcccttccctgcaagaaagagtccccagagactgggacccccagcccctggggcctccc
accccgggagtcccagacctggtggattttcagccaccccctgagctggtgcttcgagag
gctggggaggaggtccctgacgctggccccagggagggggtcagtttcccctggtccagg
cctcctgggcagggggaattcagggcccttaatgctcgcctgcccctgaacactgatgcc
tacttgtctctccaagaactccagggtcaggacccaactcacttggtgtag

KEGG   Pongo abelii (Sumatran orangutan): 100461835
Entry
100461835         CDS       T01416                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
pon05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100461835 (IL7R)
   04068 FoxO signaling pathway
    100461835 (IL7R)
   04151 PI3K-Akt signaling pathway
    100461835 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100461835 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100461835 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461835 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    100461835 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100461835 (IL7R)
   04090 CD molecules [BR:pon04090]
    100461835 (IL7R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100461835 (IL7R)
CD molecules [BR:pon04090]
 Proteins
  100461835 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 100461835
NCBI-ProteinID: XP_002815533
Ensembl: ENSPPYG00000015396
UniProt: H2PFB9
LinkDB
Position
5
AA seq 459 aa
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMH
VNLSSTKLTLLQRKLQSAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDMFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRENGKNGPHVYQDLLLSLGTTNSTLLPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgctcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcgcagcactcactgacctgtgcttttgag
gacccagatgtcaacatcaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgaatttcaggaaactacaagagatatatttcatcgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggagaaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctgagtgtcatctatcgt
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtacgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaggatgaaaacaaatggatgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaagctccaatcggcagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagcgaatgg
agtccaagttattacttcagaactccagagatcaataatagctcaggggagatggatcct
atcttactaaccatcagcattttgagttttttctctgtcgctctgttggtcatcttggcc
tgtgtgttatggaagaaaaggattaagcctatcgtatggcccagtctccctgatcataag
aagactctggaacatctttgtaagaaaccaagaaagaatttaaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagatatgtttcctcagcaactagaagaatctgagaagcagaggctt
ggaggggatgtgcagagccccaactgcccatctgaggatgtagtcatcaccccagaaagt
tttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgatgcccct
attctctcctcttccaggtccctagactgcagggagaatggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcaccctgctccctccattttct
ctccaatctggaatcctgacattgaacccagttgctcagggtcagccaattcttacttcc
ctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Pongo abelii (Sumatran orangutan): 100462256
Entry
100462256         CDS       T01416                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100462256
   04151 PI3K-Akt signaling pathway
    100462256
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100462256
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100462256
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100462256
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100462256
   04090 CD molecules [BR:pon04090]
    100462256
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100462256
CD molecules [BR:pon04090]
 Proteins
  100462256
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind Tissue_fac
Other DBs
NCBI-GeneID: 100462256
NCBI-ProteinID: XP_002834754
LinkDB
Position
X
AA seq 144 aa
GKPRAGAENLTCWIHDVDFLSCSWAVGPAAPADVQYDLYLNIANRRQQYECLHYKTDARG
TRIGCRFDDISRLSSGSQSSHILVRGRSAAFSIPCTDKFVVFSQIEILTPPNMTAKCNKT
HSFMHWKMRSHFNRKFRYELQIQK
NT seq 434 nt   +upstreamnt  +downstreamnt
gtgggaagcctcgggcaggtgcggagaatctgacctgctggattcacgatgtggatttct
tgagctgcagctgggcagtaggcccagcggcccccgctgatgtccagtacgacctgtact
tgaacattgccaacaggcgtcaacagtacgagtgtcttcactacaaaacggatgctcggg
gaacacgtatcgggtgtcgtttcgatgacatctctcgactctccagcggttctcaaagtt
cccacatcctggtgaggggcaggagcgcagccttcagtatcccctgcacagataagtttg
tcgtcttttcacagattgagatattaactccacccaacatgactgcaaagtgtaataaga
cacattccttcatgcactggaaaatgagaagtcatttcaatcgcaaatttcgctatgagc
ttcagatacaaaag

DBGET integrated database retrieval system